FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYVKRSVKVKSLSDMTAKEKFSP
LTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTVTTASALDEATLTELKTVLKSFLSKGQVLKLEVKIDPSIMG
GMIVRIGEKYVDMSAKTKIQKLSRAMR
The query sequence (length=187) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6z1u:S | 187 | 187 | 1.0000 | 1.0000 | 1.0000 | 3.53e-136 | 2jmx:A |
2 | 6tmi:G | 180 | 170 | 0.3262 | 0.3389 | 0.3588 | 6.55e-29 | |
3 | 7nkl:d | 327 | 176 | 0.2567 | 0.1468 | 0.2727 | 3.92e-09 | |
4 | 2a7u:B | 105 | 94 | 0.1283 | 0.2286 | 0.2553 | 0.005 | |
5 | 8d8j:d | 660 | 101 | 0.1658 | 0.0470 | 0.3069 | 0.80 | 8d8k:d |
6 | 7vzg:a | 858 | 67 | 0.1230 | 0.0268 | 0.3433 | 2.4 | 7vzg:A, 7vzr:A, 7vzr:a |
7 | 8oul:A | 185 | 51 | 0.0749 | 0.0757 | 0.2745 | 2.7 | 8ouk:A, 8oul:B, 8oul:C |
8 | 2uvh:A | 404 | 109 | 0.1176 | 0.0545 | 0.2018 | 3.7 | 2uvi:A, 2uvj:A |
9 | 4ryv:A | 155 | 82 | 0.1176 | 0.1419 | 0.2683 | 5.3 | |
10 | 2iop:A | 618 | 112 | 0.1711 | 0.0518 | 0.2857 | 7.0 | 2iop:B, 2iop:C, 2iop:D, 2ior:A, 1y4s:A, 1y4s:B |
11 | 2r79:A | 279 | 136 | 0.1658 | 0.1111 | 0.2279 | 7.8 |