BioLiP

>protein
EYSLAEEHIKNLPEAPEGYKWVVNEDYTDEFNGKRLNAAKWHAKSPYWTNGRPPATFKAENVSVKKGCLRIINTVLSPTE
GLDGKPGDKYRLAGGAVASVKNQAHYGYYETRMKASLTTMSSTFWLSNRPVMKEIMKIKTWSSQELDIIETMGIIRSVNP
DNPWNKTWNMQMNSNTHYWYQEQGGKRTDNTAKRSDVVSYMTDPSAEDFHTYGCWWVDANTVKFYYDGKYMYTIKPTTKY
TDTPFDRPMFIHIVTETYDWEKQVPTAEDLKDKDKSTTYYDWVRAYKLVPIE

The query sequence (length=292) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4awd:A	297	296	1.0000	0.9832	0.9865	0.0	4awd:B
2	3ilf:A	257	286	0.3014	0.3424	0.3077	4.08e-31	4ate:A
3	6hy3:A	269	281	0.2705	0.2937	0.2811	1.87e-18
4	8ep4:A	265	274	0.2466	0.2717	0.2628	9.19e-16	8ep4:B, 8ep4:C, 8ew1:A, 8ew1:B, 8ew1:C
5	7fgz:A	260	276	0.2534	0.2846	0.2681	9.01e-15
6	9int:A	282	278	0.2534	0.2624	0.2662	2.19e-09
7	1o4y:A	270	300	0.2671	0.2889	0.2600	1.43e-07	1urx:A
8	6aii:A	330	325	0.2363	0.2091	0.2123	5.70e-06
9	5ocq:B	279	227	0.1918	0.2007	0.2467	2.16e-04	5ocq:A
10	4atf:C	297	239	0.1884	0.1852	0.2301	7.83e-04	4atf:A, 4atf:B, 4atf:D
11	6t2n:AAA	278	259	0.2021	0.2122	0.2278	0.056	6t2n:BBB
12	3obv:D	327	23	0.0342	0.0306	0.4348	0.58	2bap:B, 2bap:A, 2f31:A, 8fg1:A, 3obv:A, 3obv:B, 3obv:C, 4uwx:A, 4uwx:B
13	5d6j:A	630	74	0.0685	0.0317	0.2703	0.84	5ey8:A, 5ey8:B, 5ey8:C, 5ey8:D, 5ey8:E, 5ey8:F, 5ey8:G, 5ey8:H, 5icr:A, 5icr:B, 5icr:C, 5icr:D
14	8gyg:B	305	59	0.0377	0.0361	0.1864	2.4	8gyg:A
15	3rq0:A	230	173	0.1541	0.1957	0.2601	3.4
16	4asm:B	357	125	0.0993	0.0812	0.2320	3.4
17	8pfh:C	289	78	0.0685	0.0692	0.2564	7.1
18	4eru:A	159	19	0.0308	0.0566	0.4737	8.1	4eru:B

[Back]