ETLKSANELLDSLEHSHRVDLSLHLYSAYLLKRLLYKANEKKHFYEVNQFVKTQIKDNWTSWPNPNTIIDPSVDKLYEDI
PVQPGEISNRALMHASDMMRVELDAQWQKFLSKSALDHDVTLDVDELNIPNEISRNILVKLDSLFEGLHDKIAKENEFDV
RQDKHSNKYTYHDLVSRGCEMNEDMTDIYMKSLELYNDIPEKYKKRKFRLPKQILKKYHQPKKTSSYLKELLSKTREDFI
PVEKLLKDKRLTSKDKSKLQRLNREETEDALNKRTFFQVKGYLEDENEISDYELDDCLIEL
The query sequence (length=301) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7z0o:E | 301 | 301 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6pbc:A | 1070 | 57 | 0.0598 | 0.0168 | 0.3158 | 0.52 | |
3 | 7t8t:A | 1086 | 54 | 0.0565 | 0.0157 | 0.3148 | 1.1 | |
4 | 7z3j:A | 1119 | 54 | 0.0565 | 0.0152 | 0.3148 | 1.1 | 2fci:A, 4k45:A, 7nxe:A, 2pld:A, 2ple:A, 5tq1:A, 5tqs:A, 5tqs:B, 5tqs:D, 5tqs:C, 1ywo:A |
5 | 5xwm:D | 368 | 110 | 0.0764 | 0.0625 | 0.2091 | 2.0 | 5xwm:A, 5xwm:C, 5xwm:B |
6 | 6kuj:B | 705 | 59 | 0.0598 | 0.0255 | 0.3051 | 3.3 | 6kuk:B, 6kup:B, 6kur:B, 6kut:B, 6kuu:B, 6kuv:B |
7 | 4hea:3 | 756 | 46 | 0.0498 | 0.0198 | 0.3261 | 4.0 | 2fug:3, 2fug:C, 2fug:L, 2fug:U, 4hea:D, 6i0d:3, 6i0d:D, 6i1p:3, 6i1p:D, 3i9v:3, 3i9v:C, 3iam:3, 3iam:C, 3ias:3, 3ias:C, 3ias:L, 3ias:U, 3m9s:3, 3m9s:C, 6q8o:3, 6q8o:D, 6q8w:3, 6q8w:D, 6q8x:3, 6q8x:D, 6y11:3, 6y11:D, 2ybb:3, 6ziy:3, 6zjl:3, 6zjn:3, 6zjy:3 |
8 | 8in8:C | 470 | 42 | 0.0532 | 0.0340 | 0.3810 | 8.0 | 8jl0:B, 8k87:A, 8k87:F, 8k88:A |
9 | 5ah0:B | 387 | 54 | 0.0498 | 0.0388 | 0.2778 | 8.5 | 5ah0:A |
10 | 2i6h:B | 176 | 29 | 0.0266 | 0.0455 | 0.2759 | 9.0 |