ESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQEMSNEEINAELGI
The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2l7p:A | 100 | 60 | 0.9833 | 0.5900 | 0.9833 | 1.42e-38 | 5yvx:A |
2 | 6qxz:A | 79 | 60 | 0.9833 | 0.7468 | 0.9833 | 1.70e-38 | |
3 | 5ix1:A | 414 | 53 | 0.3333 | 0.0483 | 0.3774 | 8.50e-09 | |
4 | 6o1e:A | 431 | 48 | 0.3000 | 0.0418 | 0.3750 | 4.82e-08 | 5ix1:B, 5ix2:A, 5ix2:B, 4qq4:A, 4qq4:B, 5svi:A, 5svi:B, 5svx:A, 5svy:A |
5 | 7k7t:A | 390 | 48 | 0.3167 | 0.0487 | 0.3958 | 8.66e-08 | 7k7t:B |
6 | 6o5w:A | 57 | 48 | 0.3000 | 0.3158 | 0.3750 | 1.63e-07 | |
7 | 4o62:B | 57 | 48 | 0.2833 | 0.2982 | 0.3542 | 1.29e-06 | 4o62:A, 4o62:C, 4z0o:A, 4z0r:B, 4z0r:A, 4z0r:C |
8 | 5ofb:B | 541 | 44 | 0.2167 | 0.0240 | 0.2955 | 0.025 | 5of9:A, 5of9:B, 5ofa:B, 5ofa:A, 5ofb:A |
9 | 4x2h:A | 192 | 30 | 0.1500 | 0.0469 | 0.3000 | 3.5 | 4x2o:A |
10 | 2bwr:A | 401 | 28 | 0.2000 | 0.0299 | 0.4286 | 3.9 | 2bwm:A, 2bwr:B, 2c25:A, 2c25:B, 2c4d:A, 4up4:A, 4up4:B |
11 | 2k16:A | 75 | 38 | 0.1833 | 0.1467 | 0.2895 | 5.2 | 5c13:A, 5c13:C, 5c13:E, 5c13:G, 2k17:A, 5wxg:A, 5wxh:C, 5wxh:A, 5xmy:A, 5xmy:C |
12 | 6nrz:A | 517 | 31 | 0.1667 | 0.0193 | 0.3226 | 6.8 | 6nrz:B, 6ns0:A, 6ns0:B, 6o3f:A, 6o3f:B |
13 | 4i6n:A | 219 | 32 | 0.1833 | 0.0502 | 0.3438 | 7.3 | 4i6n:C |