BioLiP

>protein
ERGRKRLGIYLAHFLDHVEGHMGEIGVQRDALAEDARLGALIDRALADMAVARASLNAVLRDL

The query sequence (length=63) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6hk5:B	66	63	1.0000	0.9545	1.0000	2.25e-38	6hk5:C, 6hk5:E, 6hk5:G, 6hk5:A, 6hk5:D, 6hk5:F, 6hk5:H
2	8unx:A	244	58	0.3016	0.0779	0.3276	1.1	7f1o:A, 7f1z:A, 7f23:A, 7f24:A, 5g53:C, 8gfv:A, 8gfw:A, 8gfx:A, 8gfy:A, 8gfz:A, 8gg0:A, 8gg1:A, 8gg2:A, 8gg3:A, 8gg4:A, 8gg5:A, 8gg6:A, 8gg7:A, 8gg8:A, 8gw8:A, 8jr9:A, 8unl:A, 8unm:A, 8unn:A, 8uno:A, 8unp:A, 8unq:A, 8unr:A, 8uns:A, 8unt:A, 8unu:A, 8unv:A, 8unw:A, 8uny:A, 8unz:A, 8uo0:A, 7vui:A, 7vuj:A
3	5b16:A	722	56	0.2857	0.0249	0.3214	5.5
4	6lxd:A	918	56	0.2857	0.0196	0.3214	5.5	9asm:A, 9asn:A, 9aso:A, 9asp:A, 9asq:A, 6v5b:A, 6v5c:A
5	6lxe:A	768	56	0.2857	0.0234	0.3214	5.8
6	8p8k:AAA	276	23	0.1587	0.0362	0.4348	7.8	8p8k:BBB, 8qrt:AAA, 8qrt:BBB, 8qrt:CCC, 8qrt:DDD, 8qs0:AAA, 8qs0:BBB, 8qs0:CCC, 8qs0:DDD
7	6eg8:I	372	56	0.2857	0.0484	0.3214	8.6	6au6:A, 1azs:C, 1azt:A, 1azt:B, 7bph:A, 8buz:B, 8bv5:B, 3c14:C, 3c15:C, 3c16:C, 1cjk:C, 1cjt:C, 1cju:C, 1cjv:C, 1cs4:C, 1cul:C, 7e5e:A, 7e5e:B, 7e5e:C, 7e5e:D, 6eg8:J, 6eg8:K, 6eg8:L, 3g82:C, 8gge:A, 8ggf:A, 2gvd:C, 2gvz:C, 3maa:C, 7pde:B, 7pdf:B, 6r3q:B, 6r4o:B, 6r4p:B, 1tl7:C, 1u0h:C, 8uo3:A
8	6pnl:A	336	35	0.2063	0.0387	0.3714	8.9	6pmh:A
9	3gaz:A	331	55	0.2698	0.0514	0.3091	9.1	3gaz:B
10	8uo1:A	334	56	0.2857	0.0539	0.3214	9.7	8gga:A

[Back]