ERGEVYSEKLFTESERTYFFNVKENRKGDYFLNIVESKRSPSGDFERHSIFVYEENINEFESNLLKAIAVIKQKVSTGSS
ARHN
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3nm7:A | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 2.00e-56 | 3n8b:A, 3n8b:B |
2 | 5yfb:A | 691 | 55 | 0.2024 | 0.0246 | 0.3091 | 1.9 | 5yfb:B, 5yfd:A, 5yfd:B |
3 | 5n6n:C | 698 | 41 | 0.1786 | 0.0215 | 0.3659 | 2.6 | 5m4a:A |
4 | 5fgp:A | 144 | 61 | 0.2024 | 0.1181 | 0.2787 | 5.5 | |
5 | 1tah:B | 318 | 35 | 0.1310 | 0.0346 | 0.3143 | 8.1 | 1cvl:A, 2es4:A, 2es4:B, 1qge:E, 1tah:A, 1tah:C, 1tah:D |
6 | 7blz:B | 731 | 56 | 0.2024 | 0.0233 | 0.3036 | 9.9 | 6fos:B, 8wey:B, 5zgb:B, 5zgh:B |