BioLiP

>protein
EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD

The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4wp4:A	43	43	1.0000	1.0000	1.0000	2.86e-26
2	4aml:A	171	30	0.5349	0.1345	0.7667	8.52e-10	4aml:B, 2cwg:B, 2cwg:A, 1wgc:A, 1wgc:B, 2wgc:B, 2x3t:A, 2x3t:B, 2x3t:C, 2x3t:D, 2x52:A, 2x52:B
3	4aml:A	171	33	0.4419	0.1111	0.5758	5.23e-06	4aml:B, 2cwg:B, 2cwg:A, 1wgc:A, 1wgc:B, 2wgc:B, 2x3t:A, 2x3t:B, 2x3t:C, 2x3t:D, 2x52:A, 2x52:B
4	4aml:A	171	31	0.4186	0.1053	0.5806	1.30e-05	4aml:B, 2cwg:B, 2cwg:A, 1wgc:A, 1wgc:B, 2wgc:B, 2x3t:A, 2x3t:B, 2x3t:C, 2x3t:D, 2x52:A, 2x52:B
5	4aml:A	171	38	0.4651	0.1170	0.5263	4.48e-05	4aml:B, 2cwg:B, 2cwg:A, 1wgc:A, 1wgc:B, 2wgc:B, 2x3t:A, 2x3t:B, 2x3t:C, 2x3t:D, 2x52:A, 2x52:B
6	1uha:A	82	40	0.5581	0.2927	0.6000	3.36e-09
7	1uha:A	82	40	0.4651	0.2439	0.5000	1.25e-07
8	6sto:A	165	39	0.4884	0.1273	0.5385	1.42e-06	6sto:B, 6stp:A, 6stp:B
9	6sto:A	165	32	0.4419	0.1152	0.5938	6.42e-06	6sto:B, 6stp:A, 6stp:B
10	6sto:A	165	24	0.3721	0.0970	0.6667	2.82e-05	6sto:B, 6stp:A, 6stp:B
11	6sto:A	165	39	0.4419	0.1152	0.4872	0.002	6sto:B, 6stp:A, 6stp:B
12	6lnr:A	292	32	0.4186	0.0616	0.5625	2.11e-04
13	4z8i:A	224	16	0.2093	0.0402	0.5625	0.45
14	4qi7:A	805	30	0.2093	0.0112	0.3000	2.2	4qi7:B
15	1bru:P	241	28	0.2558	0.0456	0.3929	5.6
16	8f0p:A	1116	26	0.2093	0.0081	0.3462	6.4	8f0q:A, 8f0r:A, 8f0s:A
17	6a91:A	1323	26	0.2093	0.0068	0.3462	6.4	6a95:A, 6nt3:A, 6nt4:A
18	9cer:P	609	28	0.2326	0.0164	0.3571	8.2	9ces:P, 9cet:P
19	7vfs:A	1266	23	0.1860	0.0063	0.3478	8.8	7vfu:A, 7vfv:A, 7vfw:A
20	7mix:A	1326	23	0.1860	0.0060	0.3478	8.8	7miy:A

[Back]