EPVKDTNGNPLKIETRYFIQPASGGGLVPANVDLSHLCPLGIVRTSLPYQPGLPVTISTPNDVLTNTNIAITFDAPIWPC
PSSKTWTVDSSSEEKYIITGGDPKSGESFFRIEKYGNGKNTYKLVRYGKSVGSTKSLWGPALVLNDDDDSDENAFPIKFR
EVD
The query sequence (length=163) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dre:C | 177 | 175 | 0.9939 | 0.9153 | 0.9257 | 1.26e-110 | 2dre:A, 2dre:B, 2dre:D, 6giw:A, 6giw:B, 6giw:C, 6giw:D, 6gix:A, 6gix:B, 6gix:C, 6gix:D, 6s2y:A, 6s2y:B, 6s2y:D, 6s2y:C |
2 | 5hpz:A | 175 | 178 | 0.4724 | 0.4400 | 0.4326 | 6.95e-36 | 5hpz:B, 6s2z:A |
3 | 8wfo:B | 191 | 134 | 0.2331 | 0.1990 | 0.2836 | 3.50e-04 | 8wfo:A |
4 | 6ntt:B | 176 | 132 | 0.2270 | 0.2102 | 0.2803 | 0.015 | 6ntt:A |
5 | 8vql:A | 325 | 61 | 0.1227 | 0.0615 | 0.3279 | 0.029 | 1rvx:A, 1rvx:C, 1rvx:E, 1rvx:G, 1rvx:I, 1rvx:K, 1rvz:A, 1rvz:C, 1rvz:E, 1rvz:G, 1rvz:I, 1rvz:K, 8sd2:A, 8sd4:A, 8vqm:A, 8vqn:A, 8vqq:A, 5w5s:A, 5w5u:A, 5w6i:A, 5w6r:A, 5w6r:C, 5w6r:E, 5w6r:G, 5w6t:A, 5w6u:A, 6wcr:A |
6 | 4wbc:A | 179 | 130 | 0.2209 | 0.2011 | 0.2769 | 0.12 | |
7 | 6n41:A | 483 | 58 | 0.1043 | 0.0352 | 0.2931 | 1.8 | 6cf7:B, 7jpd:D, 8sd2:B, 8sd4:B, 7uyi:E, 8vql:B, 8vqm:B, 8vqn:B, 8vqq:B, 5w5s:B, 5w5u:B, 5w6i:B, 5w6r:B, 5w6r:D, 5w6r:F, 5w6r:H, 5w6t:B, 5w6u:B, 6wcr:B, 2wrg:M |
8 | 6cf7:A | 322 | 60 | 0.1043 | 0.0528 | 0.2833 | 1.9 | 6lks:A, 6lks:K, 6lks:G, 6lks:I |
9 | 6i52:B | 132 | 38 | 0.0736 | 0.0909 | 0.3158 | 2.3 | |
10 | 2dcn:A | 308 | 103 | 0.1411 | 0.0747 | 0.2233 | 3.5 | 2dcn:B, 2dcn:C, 2dcn:D, 2dcn:E, 2dcn:F, 2dcn:G, 2dcn:H, 2dcn:I, 2dcn:J, 2dcn:K, 2dcn:L |
11 | 7uac:H | 546 | 44 | 0.0920 | 0.0275 | 0.3409 | 3.6 | 7uab:E, 7uab:H, 7uae:A, 7uaf:B, 7uaf:A, 7uaf:C, 7uaf:D, 7uai:E, 7uai:B, 7uai:C, 7uai:D |
12 | 8i9r:Cg | 233 | 52 | 0.0982 | 0.0687 | 0.3077 | 4.0 | 8i9t:Cg |
13 | 6c0f:A | 394 | 49 | 0.1043 | 0.0431 | 0.3469 | 4.7 | 6cb1:A, 6em1:5, 6em3:5, 6em4:5, 7ohs:5, 7ohw:5, 7ohx:5, 8v83:I, 8v84:I, 5z3g:V |
14 | 3nix:A | 407 | 32 | 0.0675 | 0.0270 | 0.3438 | 5.5 | 3nix:B, 3nix:C, 3nix:D, 3nix:E, 3nix:F, 3nix:G, 3nix:H |
15 | 5db4:B | 175 | 73 | 0.1288 | 0.1200 | 0.2877 | 7.0 | |
16 | 1rv0:L | 324 | 59 | 0.1043 | 0.0525 | 0.2881 | 7.8 | 1rvt:H, 1rvt:J, 1rvt:L |