BioLiP

>protein
EPRGVVRITCPVALLQATVSTMLADFMASCPLVTIHLEATNRQVDPVAEAIDIAIRVRPPPLQNSDLVLRVLGNRCQCLV
ASPELIGRQGEVNTPVDLTGWPSLGLGQPQQTFIWNLEGPEKAHAAVYHQPRLVTADMNTLRSAALAGVGVVQLPLMMVT
EQLAEGTLVRLLPDWSVRHEIIHAVYPSRRGLLPSVRSVLDYLVQRFSQLDER

The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7trw:A	213	213	1.0000	1.0000	1.0000	1.02e-155
2	4wkm:A	197	149	0.1878	0.2030	0.2685	7.01e-08	4wkm:B, 4wkm:C, 4wkm:D, 4wkm:E, 4wkm:F, 4wkm:G, 4wkm:H
3	8h5a:F	204	56	0.1033	0.1078	0.3929	5.24e-04	8h5a:A, 8h5a:B, 8h5a:C, 8h5a:D, 8h5a:E, 8h5a:G, 8h5a:H, 8h5a:I, 8h5a:J, 8h5a:K, 8h5a:L, 8h5a:M, 8h5a:N, 8h5a:O, 8h5a:P
4	8ro0:E	312	109	0.1268	0.0865	0.2477	0.067	8ro1:E
5	3fd3:A	207	97	0.1362	0.1401	0.2990	0.31
6	1jmx:B	339	87	0.0939	0.0590	0.2299	0.64	1jmz:B
7	4v8p:BI	198	51	0.0845	0.0909	0.3529	0.95	4v8p:CI, 4v8p:EI, 4v8p:GI
8	6evj:C	748	66	0.0751	0.0214	0.2424	2.8	6evj:F, 6evk:C, 9f2r:C, 9f37:C, 6fhh:C, 6fhi:C, 5m3h:C, 6szu:C, 6szv:C, 6t0n:C, 6t0r:C, 6t0s:C, 6t0u:C, 6t0v:C, 6tw1:C, 4wsb:C
9	5z49:B	220	73	0.0939	0.0909	0.2740	3.3	5z49:A
10	6rw7:A	208	104	0.1268	0.1298	0.2596	3.6
11	3fxx:A	288	58	0.0845	0.0625	0.3103	6.3	3dzq:A, 3fy2:A, 4g2f:A, 4gk2:A, 4gk3:A, 4gk4:A, 6in0:A, 4p4c:A, 4p5q:A, 4p5z:A, 2qo7:A, 2qo9:A, 2qoc:A, 2qoq:A, 4twn:A, 4two:A
12	3qnm:A	231	29	0.0469	0.0433	0.3448	7.5
13	5ydv:A	209	51	0.0610	0.0622	0.2549	7.7
14	5awh:A	759	25	0.0563	0.0158	0.4800	8.0	6d8a:A, 6d8a:F, 6d8f:A, 6d8f:F, 6d8p:A, 6d8p:B, 6d92:A, 6d92:F, 6d95:A, 6d95:F, 6d9k:A, 6d9k:F, 6d9l:A, 6d9l:F
15	7d54:A	242	36	0.0751	0.0661	0.4444	8.1	7d54:B
16	6p8v:G	320	55	0.0939	0.0625	0.3636	9.2	6p80:A, 6u7b:A, 6u7b:C

[Back]