ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRD
REDRRAILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
The query sequence (length=141) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3gfi:A | 143 | 141 | 0.9929 | 0.9790 | 0.9929 | 3.96e-97 | 3gez:A, 3gfj:A, 3gfl:A, 3gfm:A, 2yr2:B |
2 | 5e1z:B | 169 | 125 | 0.2128 | 0.1775 | 0.2400 | 4.82e-10 | 5e1x:A, 5e20:A |
3 | 3q5f:A | 141 | 135 | 0.2553 | 0.2553 | 0.2667 | 5.84e-09 | 3q5f:B |
4 | 4xrf:A | 142 | 84 | 0.2057 | 0.2042 | 0.3452 | 3.01e-08 | |
5 | 4aij:B | 142 | 132 | 0.2411 | 0.2394 | 0.2576 | 6.75e-08 | 4aij:A, 4aik:A |
6 | 2fbh:A | 137 | 132 | 0.3262 | 0.3358 | 0.3485 | 2.71e-07 | |
7 | 1z9c:C | 138 | 92 | 0.1773 | 0.1812 | 0.2717 | 5.06e-07 | 1z9c:A, 1z9c:B, 1z9c:D, 1z9c:E, 1z9c:F |
8 | 5hli:A | 146 | 133 | 0.1844 | 0.1781 | 0.1955 | 1.29e-06 | 5hlg:A, 5hlg:B, 5hlg:C, 5hlg:D, 5hlg:E, 5hlg:F, 5hlg:G, 5hlg:H, 5hlh:A, 5hlh:B, 5hlh:C, 5hlh:D, 5hlh:E, 5hlh:F, 5hlh:G, 5hlh:H, 5hli:B |
9 | 4rgu:B | 144 | 141 | 0.2340 | 0.2292 | 0.2340 | 9.38e-06 | 5bmz:A, 5bmz:B, 5bmz:C, 5bmz:D, 4rgs:A, 4rgs:B, 4rgu:A |
10 | 6jbx:A | 146 | 93 | 0.1560 | 0.1507 | 0.2366 | 1.29e-05 | 6jbx:B |
11 | 7kfq:A | 141 | 68 | 0.1702 | 0.1702 | 0.3529 | 3.80e-04 | 7kfo:A, 7kh3:A, 7kig:A, 7kjq:A, 7kk0:A, 7kkc:A, 7kki:A |
12 | 5yhx:N | 146 | 84 | 0.1773 | 0.1712 | 0.2976 | 6.72e-04 | 5yhx:A, 5yhx:B, 5yhx:G, 5yhx:H, 5yhx:M, 5yhx:S, 5yhx:T, 5yhy:A, 5yhz:A, 5yi0:B, 5yi0:A, 5yi0:C, 5yi0:D, 5yi2:A, 5yi2:B, 5yi2:E, 5yi2:F, 5yi2:I, 5yi2:J, 5yi2:M, 5yi2:N, 5yi3:A, 5yi3:B, 5yi3:E, 5yi3:F, 5yi3:I, 5yi3:J, 5yi3:M, 5yi3:N |
13 | 5cyv:B | 143 | 36 | 0.1489 | 0.1469 | 0.5833 | 7.14e-04 | 5cyv:A, 3fm5:C |
14 | 4fx4:B | 133 | 111 | 0.2199 | 0.2331 | 0.2793 | 0.001 | 4fx4:A |
15 | 5aip:A | 141 | 72 | 0.1348 | 0.1348 | 0.2639 | 0.001 | 5aip:B |
16 | 5h3r:A | 141 | 106 | 0.2128 | 0.2128 | 0.2830 | 0.001 | 5h3r:B |
17 | 7kua:A | 149 | 114 | 0.1986 | 0.1879 | 0.2456 | 0.005 | |
18 | 7el3:A | 138 | 86 | 0.1702 | 0.1739 | 0.2791 | 0.006 | 7el3:B |
19 | 6c2s:A | 142 | 72 | 0.1489 | 0.1479 | 0.2917 | 0.012 | 6c28:A, 6c28:D, 6c28:B, 6c28:C, 6c2s:D, 6c2s:B, 6c2s:C |
20 | 4em0:B | 150 | 135 | 0.2340 | 0.2200 | 0.2444 | 0.012 | |
21 | 6fi9:A | 144 | 77 | 0.1418 | 0.1389 | 0.2597 | 0.023 | 6fi9:B, 6fi9:C, 6fi9:D, 6fi9:E, 6fi9:F, 6fi9:G, 6fi9:H |
22 | 3hsr:B | 133 | 98 | 0.2199 | 0.2331 | 0.3163 | 0.067 | 3hsr:A, 3hsr:C, 3hsr:D |
23 | 3zpl:E | 160 | 88 | 0.1560 | 0.1375 | 0.2500 | 1.4 | 3zpl:A, 3zpl:B, 3zpl:F |
24 | 8y6u:H | 92 | 93 | 0.1844 | 0.2826 | 0.2796 | 2.4 | 8y6u:J |
25 | 7smg:B | 144 | 44 | 0.1277 | 0.1250 | 0.4091 | 2.7 | 7smg:A, 7smg:C, 7smg:D |
26 | 6eri:BM | 111 | 25 | 0.0780 | 0.0991 | 0.4400 | 3.7 | 5mmj:m, 5mmm:m |
27 | 7tzc:A | 4404 | 46 | 0.1135 | 0.0036 | 0.3478 | 4.1 | 3rqr:A, 8sen:A, 8sen:B, 8sen:C, 8sen:D, 8seo:A, 8seo:B, 8seo:C, 8seo:D, 8sep:A, 8sep:B, 8sep:C, 8sep:D, 8seq:A, 8seq:B, 8seq:C, 8seq:D, 8ser:A, 8ser:B, 8ser:C, 8ser:D, 8ses:A, 8ses:B, 8ses:C, 8ses:D, 8set:A, 8set:B, 8set:C, 8set:D, 7tzc:B, 7tzc:G, 7tzc:I |
28 | 2vbw:A | 147 | 41 | 0.1064 | 0.1020 | 0.3659 | 4.2 | 2vbx:A, 2vby:A, 2vbz:A, 2vc0:A, 2vc1:A, 2w24:A |
29 | 5dte:B | 287 | 46 | 0.0922 | 0.0453 | 0.2826 | 5.4 | 5dte:A, 5dte:C, 5dte:D |
30 | 8uhe:J | 167 | 150 | 0.2553 | 0.2156 | 0.2400 | 6.0 |