EMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAKRLKDVEWVKLHRLLQRALFRQL
KRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLWEINETEFIRCGCL
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7c79:L | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 6.80e-94 | 7c7a:L, 6w6v:L |
2 | 8gcc:A | 707 | 47 | 0.1450 | 0.0269 | 0.4043 | 0.46 | 8gcc:B |
3 | 1zgl:P | 242 | 110 | 0.2366 | 0.1281 | 0.2818 | 1.3 | 5bs0:E, 8f5a:D, 4qrr:E, 8vcy:E, 8vd2:E, 1zgl:V, 1zgl:R, 1zgl:T |
4 | 6f0k:A | 207 | 44 | 0.1450 | 0.0918 | 0.4318 | 1.9 | |
5 | 7wkp:A | 167 | 105 | 0.1908 | 0.1497 | 0.2381 | 4.2 | 8k0k:I, 8k22:H, 8k23:H, 8k23:h, 8k24:h, 8k24:H, 8k27:I, 8k28:I, 8k29:I, 7wwu:I |
6 | 6zz6:B | 423 | 45 | 0.0840 | 0.0260 | 0.2444 | 4.3 | |
7 | 6cxo:A | 465 | 42 | 0.1145 | 0.0323 | 0.3571 | 9.2 | 6cxo:B |