EMAAALVAAFGGKENITNLDACITRLRVSVADVSKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRN
The query sequence (length=77) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1o2f:B | 77 | 77 | 1.0000 | 1.0000 | 1.0000 | 1.10e-50 | |
2 | 7xya:C | 1190 | 28 | 0.1818 | 0.0118 | 0.5000 | 0.20 | 7xyb:C |
3 | 7f0r:C | 1324 | 28 | 0.1818 | 0.0106 | 0.5000 | 0.21 | |
4 | 8h97:A | 619 | 34 | 0.1948 | 0.0242 | 0.4412 | 0.51 | |
5 | 7wiv:A | 571 | 31 | 0.1558 | 0.0210 | 0.3871 | 0.76 | 7wiw:A, 7wix:A |
6 | 5eer:A | 247 | 21 | 0.1299 | 0.0405 | 0.4762 | 3.1 | 5ees:A |
7 | 1j1v:A | 94 | 27 | 0.1558 | 0.1277 | 0.4444 | 3.6 | |
8 | 6wmp:C | 1196 | 28 | 0.1429 | 0.0092 | 0.3929 | 3.8 | 6wmr:C, 6wmt:C |
9 | 6j9f:C | 1296 | 28 | 0.1429 | 0.0085 | 0.3929 | 9.0 |