BioLiP

>protein
ELNAVDAKLTTDFGQKIDLNNSDIRDFRGLRGFYPNLASEIIKNAPYDTVEEVLDIPGLSETQKSRLEANLGSFTVTEPS
IELTSGDDRINPGVY

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7n8o:U	95	95	1.0000	1.0000	1.0000	1.60e-65	7n8o:u, 7rcv:U, 7rcv:u, 8tow:U, 8tow:u
2	8wql:UD	95	95	0.5579	0.5579	0.5579	4.43e-32	8wql:UE, 8wql:U1, 8wql:u1, 8wql:uD, 8wql:uE
3	3l7m:D	412	51	0.1368	0.0316	0.2549	1.2	3l7k:A, 3l7k:D, 3l7k:C, 3l7l:D, 3l7m:A, 3l7m:B, 3l7m:C
4	3swj:A	246	63	0.2105	0.0813	0.3175	1.5
5	3wqo:A	271	38	0.1474	0.0517	0.3684	2.1	3wqo:B
6	1b90:A	516	69	0.2105	0.0388	0.2899	3.5	1b9z:A, 5bca:A, 5bca:B, 5bca:C, 5bca:D, 1itc:A, 1j0y:A, 1j0y:B, 1j0y:C, 1j0y:D, 1j0z:A, 1j0z:B, 1j0z:C, 1j0z:D, 1j10:A, 1j10:B, 1j10:C, 1j10:D, 1j11:A, 1j11:B, 1j11:C, 1j11:D, 1j12:A, 1j12:B, 1j12:C, 1j12:D, 1j18:A, 1vem:A, 1ven:A, 1veo:A, 1vep:A, 8zrz:A
7	6s0k:h	838	47	0.1579	0.0179	0.3191	5.2	5k9t:A, 2vda:A
8	2fsh:A	691	47	0.1579	0.0217	0.3191	6.8	3bxz:A, 3bxz:B, 2fsg:A, 2fsi:A
9	2fsh:B	722	47	0.1579	0.0208	0.3191	6.9
10	2fsi:B	748	47	0.1579	0.0201	0.3191	7.2	2fsg:B
11	7oln:AAA	134	28	0.1368	0.0970	0.4643	7.7	8bro:A, 7olu:AAA, 7olw:AAA, 6tid:AAA, 6tig:AAA, 6tig:CCC, 6tig:BBB, 2wq4:A, 2wq4:C, 2wq4:B, 6zzw:A, 6zzw:C, 6zzw:B
12	1zzh:B	308	30	0.1158	0.0357	0.3667	8.0	1zzh:A, 1zzh:C, 1zzh:D
13	8i23:C	1164	25	0.1158	0.0095	0.4400	8.5	8i24:C

[Back]