ELLHPLPVRARKMEWLKRDAVEENEEILRRPYYTIKSYALPPAVGRQESIHNSNNIRGGMHSSHSLDLIMRQPRRVKTPE
QLRALRDRLRFIGVTGPMPQATSVSTKSYTDTYGSRLRPRYPESWDTVPPHQPSRELL
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aoi:At | 145 | 138 | 1.0000 | 0.9517 | 1.0000 | 3.50e-99 | 6hiv:At, 6hix:At, 6yxx:At, 6yxy:At |
2 | 7am2:Af | 145 | 137 | 0.5362 | 0.5103 | 0.5401 | 1.16e-42 | 7aih:Af, 7ane:Af |
3 | 7rhw:A | 437 | 60 | 0.1087 | 0.0343 | 0.2500 | 0.86 | 7rhv:A, 7rhv:B, 7rhw:B, 7ri0:A, 7ri0:B |
4 | 7vrd:A | 439 | 61 | 0.1159 | 0.0364 | 0.2623 | 1.0 | 7vrd:B, 7vrd:C, 7vrd:D |
5 | 7mq8:LH | 746 | 44 | 0.1232 | 0.0228 | 0.3864 | 1.0 | 7mq9:LH, 7mqa:LH |
6 | 3ozb:A | 241 | 45 | 0.1232 | 0.0705 | 0.3778 | 2.7 | 3ozb:B, 3ozb:C, 3ozb:D, 3ozb:E, 3ozb:F |
7 | 3vuf:A | 488 | 27 | 0.0725 | 0.0205 | 0.3704 | 3.1 | |
8 | 6a9t:A | 417 | 93 | 0.1667 | 0.0552 | 0.2473 | 3.7 | 6a9u:A, 6a9v:A |
9 | 5vyj:A | 918 | 25 | 0.0725 | 0.0109 | 0.4000 | 3.9 | 1jqo:A, 1jqo:B, 6mgi:A, 6mgi:B, 5vyj:B, 5vyj:C, 5vyj:D |
10 | 8iuf:4F | 75 | 43 | 0.0942 | 0.1733 | 0.3023 | 4.4 | 8iuj:4F, 8iuj:4f |