BioLiP

>protein
EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEV

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2kn7:A	67	67	1.0000	1.0000	1.0000	2.83e-46	2kn7:D
2	7by1:A	287	60	0.2537	0.0592	0.2833	0.34	7by1:B
3	3sfz:A	1133	39	0.2090	0.0124	0.3590	0.72	3shf:A
4	7w02:A	1566	47	0.2388	0.0102	0.3404	0.99
5	7nkg:F	247	49	0.2537	0.0688	0.3469	1.4	7nkg:C, 7nkg:L, 7nkg:I
6	9biw:B	528	36	0.1642	0.0208	0.3056	3.4	9biw:A
7	8bja:A	1563	49	0.2388	0.0102	0.3265	3.7
8	5li6:A	377	34	0.1791	0.0318	0.3529	3.8	5li6:B, 5li7:A, 5li7:B
9	4nw5:A	302	31	0.1940	0.0430	0.4194	3.8	5d9k:A, 5d9k:B, 5d9l:A, 4el9:A, 8eq5:A, 4gue:A, 4nus:A, 4nw6:A, 7opo:A, 7opo:C, 7opo:E, 7opo:G, 7opo:I, 7opo:K, 3ubd:A, 8xfy:A, 8xfy:G, 8xfy:H
10	8bja:B	1638	49	0.2388	0.0098	0.3265	3.9
11	3g51:A	280	31	0.1940	0.0464	0.4194	4.1	8xfy:B, 8xfy:C, 8xfy:D, 8xfy:E, 8xfy:F, 8xfy:I, 8xfy:J
12	8e0q:A	1689	49	0.2388	0.0095	0.3265	4.1	8d4x:A, 8e0q:B
13	8ewi:A	1775	49	0.2388	0.0090	0.3265	4.1	8ewi:B, 8ewi:C, 8ewi:D
14	8p82:A	1596	49	0.2388	0.0100	0.3265	4.2	8p82:B
15	8d4x:B	1669	49	0.2388	0.0096	0.3265	4.3	8c06:A, 8c06:D
16	8wm6:n	181	40	0.2090	0.0773	0.3500	5.1	8wmj:n, 8wmv:n
17	1e6y:F	247	53	0.2090	0.0567	0.2642	7.2	1e6y:C, 8gf5:E
18	4iao:B	429	47	0.1940	0.0303	0.2766	7.2	2hjh:A, 2hjh:B, 4iao:A
19	8c07:B	450	49	0.2388	0.0356	0.3265	9.9

[Back]