EKEWVEQDEPGVYITLTALAGGARDLKRVRFSRKRFSEIQAEQWWADNRGRVYEQYNVRMV
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6l0v:A | 61 | 61 | 1.0000 | 1.0000 | 1.0000 | 2.16e-40 | 6l0v:C, 6l0v:E, 6l0v:G, 6l0w:A, 6l0w:C |
2 | 3mbe:C | 192 | 54 | 0.2459 | 0.0781 | 0.2778 | 0.50 | 3mbe:G |
3 | 4ci0:A | 385 | 20 | 0.1475 | 0.0234 | 0.4500 | 0.91 | 4omf:A |
4 | 2eek:A | 220 | 20 | 0.1639 | 0.0455 | 0.5000 | 1.1 | |
5 | 6mss:A | 181 | 54 | 0.2459 | 0.0829 | 0.2778 | 1.2 | |
6 | 2ro1:A | 189 | 50 | 0.2459 | 0.0794 | 0.3000 | 1.3 | |
7 | 3h70:A | 342 | 19 | 0.1311 | 0.0234 | 0.4211 | 1.6 | |
8 | 6z1h:A | 382 | 31 | 0.1967 | 0.0314 | 0.3871 | 2.7 | |
9 | 6z1m:A | 423 | 32 | 0.1967 | 0.0284 | 0.3750 | 2.7 | 6z1m:B, 6z1m:C |
10 | 4ub9:A | 467 | 62 | 0.2787 | 0.0364 | 0.2742 | 3.2 | 4ub9:B, 4ub9:C, 4ub9:D, 4ub9:E, 4ub9:F, 4ub9:G, 4wgx:A |
11 | 4m00:A | 501 | 30 | 0.1639 | 0.0200 | 0.3333 | 3.3 | 4m01:A, 4m01:B, 4m01:C, 4m01:D, 4m02:A, 4m03:A |
12 | 3a8g:B | 212 | 63 | 0.3279 | 0.0943 | 0.3175 | 4.9 | 3a8h:B, 3a8m:B, 3a8o:B, 2cz1:B, 2cz6:B, 2d0q:B, 2qdy:B, 3x26:B |
13 | 3s6h:A | 436 | 35 | 0.2295 | 0.0321 | 0.4000 | 7.1 | 4kzt:A, 4kzt:B, 4kzt:X, 4kzt:Y, 3s6g:B, 3s6g:Y, 3s6h:X, 3s6h:B, 3s6h:Y |
14 | 1a5i:A | 265 | 20 | 0.1639 | 0.0377 | 0.5000 | 8.6 |