BioLiP

>protein
EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

The query sequence (length=39) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1fre:A	39	39	1.0000	1.0000	1.0000	1.57e-23
2	2egm:A	57	37	0.4103	0.2807	0.4324	6.73e-07
3	5olm:B	132	39	0.4359	0.1288	0.4359	2.75e-06	5jpx:A, 5olm:A
4	4tn3:B	362	35	0.3333	0.0359	0.3714	4.84e-06	5k3q:A, 5k3q:B, 5k3q:C, 5k3q:D, 4tn3:A, 5w9a:A, 5w9a:B
5	2yrg:A	59	37	0.3590	0.2373	0.3784	7.48e-06
6	7xyz:B	456	38	0.4103	0.0351	0.4211	1.43e-05	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
7	2did:A	53	37	0.3590	0.2642	0.3784	1.21e-04	2dif:A
8	7xt2:B	388	36	0.3590	0.0361	0.3889	1.72e-04	7xt2:A
9	5va4:A	123	34	0.3333	0.1057	0.3824	3.07e-04
10	5eiu:A	134	35	0.3077	0.0896	0.3429	7.54e-04	5eiu:D, 5f7t:E, 5f7t:F, 5f7t:H, 5f7t:L, 5iea:A, 5iea:B, 5iea:C, 5iea:D, 5iea:F, 5iea:K
11	2jun:A	101	35	0.3333	0.1287	0.3714	0.13	2dq5:A
12	2csv:A	72	38	0.2821	0.1528	0.2895	0.98
13	2yho:E	70	18	0.2051	0.1143	0.4444	1.2	2yhn:A, 2yhn:B, 2yho:A, 2yho:C, 2yho:G
14	2dja:A	84	35	0.2821	0.1310	0.3143	1.4
15	8i6y:A	844	23	0.2821	0.0130	0.4783	2.2	8i6y:B
16	6y2x:B	177	26	0.3077	0.0678	0.4615	3.8
17	2cd9:A	363	22	0.2308	0.0248	0.4091	8.1	2cd9:B, 2cda:A, 2cda:B, 2cdb:A, 2cdb:B, 2cdb:C, 2cdb:D, 2cdc:A, 2cdc:B, 2cdc:C, 2cdc:D

[Back]