EIVEVQGGHIIRATGRKDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKKAKTAIDKL
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7vp2:A | 83 | 74 | 1.0000 | 0.8916 | 1.0000 | 1.52e-49 | 7vp1:A, 7vp1:B, 7vp2:B, 7vp4:B, 7vp4:A, 7vp4:F, 7vp4:E, 7vp4:J, 7vp4:I, 7vp5:A, 7vp5:B, 7vp5:E, 7vp5:F, 7vp5:I, 7vp5:J, 7vp7:A, 7vp7:B |
2 | 7vp3:C | 62 | 55 | 0.2568 | 0.3065 | 0.3455 | 5.19e-06 | 7vp3:D, 7vp3:J, 7vp3:G, 7vp3:L, 7vp3:I, 7vp3:N, 7vp3:P |
3 | 6xpn:B | 259 | 33 | 0.1351 | 0.0386 | 0.3030 | 1.7 | 6xpn:A |
4 | 3o8l:A | 748 | 45 | 0.2432 | 0.0241 | 0.4000 | 2.5 | 3o8l:B, 3o8n:A, 3o8n:B |
5 | 2yck:X | 272 | 49 | 0.1757 | 0.0478 | 0.2653 | 3.3 | 2yci:X, 2ycj:A |
6 | 3no5:E | 275 | 17 | 0.1216 | 0.0327 | 0.5294 | 6.3 | 3no5:A, 3no5:B, 3no5:C, 3no5:D, 3no5:F |
7 | 6pim:A | 200 | 28 | 0.1351 | 0.0500 | 0.3571 | 7.7 | |
8 | 8gy9:A | 249 | 34 | 0.1757 | 0.0522 | 0.3824 | 8.4 | 8gy9:B, 8gya:A, 8gya:B, 8gyb:A, 8gyb:B, 8gyb:C, 8gyb:D |
9 | 6vfp:A | 439 | 27 | 0.1351 | 0.0228 | 0.3704 | 8.7 | 6bx7:A, 6mga:A |