EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVK
The query sequence (length=130) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
3ey1:A |
137 |
130 |
1.0000 |
0.9489 |
1.0000 |
9.03e-93 |
8cty:G, 8cty:E, 8cty:C, 8cty:F, 8ctz:B, 8cu0:C, 3d0p:A, 3d0p:C, 6dmn:A, 6dmv:A, 6do8:A, 6do9:A, 6doa:A, 6dob:A, 6doc:A, 6dod:A, 6doe:A, 6dof:A, 6dog:A, 6doh:A, 6doi:A, 6doj:A, 6dok:A, 6dol:A, 6dom:A, 6don:A, 6doo:A, 6dop:A, 6doq:A, 6dor:A, 6dos:A, 6dot:A, 6dou:A, 6dov:A, 6dow:A, 6dox:A, 6doy:A, 6doz:A, 6dp0:A, 6dp1:A, 6dp2:A, 6dp3:A, 6dp4:A, 6dp5:A, 6dp6:A, 6dp7:A, 6dp8:A, 6dp9:A, 6dpa:A, 6dpb:A, 6dpc:A, 6dpd:A, 6dpe:A, 6dpf:A, 6dpg:A, 6dph:A, 6dpi:A, 6dpj:A, 6dpk:A, 6dpl:A, 6dpm:A, 6dpn:A, 6dpo:A, 6dpp:A, 2g8f:A, 2g8h:A, 2g8i:A, 2g8k:A, 2g8u:A, 2g8v:A, 2g8w:A, 4htu:A, 4htu:B, 4hue:A, 4hue:B, 4huf:A, 4huf:B, 4hug:A, 4hug:B, 3i8d:A, 3i8d:C, 4opj:A, 4opj:C, 4opk:A, 4opk:C, 2r7y:A, 8sv3:A, 8sv4:A, 5swm:A, 5swm:B, 3twh:A, 3uld:A, 5us2:A, 5usa:A, 5use:A, 5usg:A, 5vaj:A, 5vaj:B, 5w7n:A, 5w7o:A, 5wjr:A, 1zbi:A, 1zbi:B, 1zbl:A, 1zbl:B |
2 |
3ery:B |
149 |
55 |
0.1154 |
0.1007 |
0.2727 |
1.3 |
|
3 |
3h08:B |
142 |
51 |
0.1385 |
0.1268 |
0.3529 |
2.0 |
|
4 |
4txd:A |
336 |
71 |
0.1615 |
0.0625 |
0.2958 |
2.2 |
|
5 |
4msx:A |
395 |
102 |
0.2000 |
0.0658 |
0.2549 |
2.3 |
|
6 |
8ye0:C |
290 |
20 |
0.0846 |
0.0379 |
0.5500 |
4.4 |
8ye0:A, 8ye0:B, 8ye0:D |
7 |
7f3x:A |
449 |
82 |
0.1692 |
0.0490 |
0.2683 |
4.6 |
7f3x:B, 7f40:A, 7f40:B |
8 |
7pog:A |
2382 |
80 |
0.1769 |
0.0097 |
0.2875 |
7.3 |
4dmw:A, 3ho6:A, 3ho6:B, 4r04:A, 3srz:A, 3ss1:A, 7u2p:A, 7uby:B, 7uby:A, 5uqk:A, 5uql:A |
9 |
6fxc:At |
81 |
65 |
0.1308 |
0.2099 |
0.2615 |
8.4 |
7aso:A, 7asp:j, 7bgd:t, 8bh6:t, 8bh7:t, 8byv:t, 6fxc:Bt, 7kwg:t, 5li0:t, 5nd8:t, 5nd9:t, 5ngm:At, 7nhl:u, 7nhm:u, 8p2f:u, 8p2g:u, 8p2h:u, 7p48:t, 6s0x:t, 6s13:t, 5t7v:SA, 5tcu:SA, 8y38:t, 8y39:t, 6yef:t |