BioLiP

>protein
EIDAGYSSDSSTEDPYPDYDDFFTNTVRETPLSSAPEPKRRFAPSKHEQKRILQLAYAIRKGRILTSEQRAERER

The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8eth:m	76	76	1.0000	0.9868	0.9868	1.64e-48	8eup:m, 8ev3:m
2	8euy:m	92	92	0.9733	0.7935	0.7935	2.60e-44
3	8esq:m	572	62	0.8267	0.1084	1.0000	1.49e-37	8esr:m, 8etg:m, 8eti:m, 8eug:m, 8eui:m
4	8esq:m	572	25	0.2133	0.0280	0.6400	0.001	8esr:m, 8etg:m, 8eti:m, 8eug:m, 8eui:m
5	8i9x:CC	658	54	0.4400	0.0502	0.6111	1.96e-16	8i9r:CC, 8i9t:CC, 8i9v:CC, 8i9w:CC, 8i9y:CC, 8i9z:CC, 8ia0:CC, 8pv2:CC
6	8i9p:CC	258	54	0.4400	0.1279	0.6111	2.22e-16
7	7nac:m	666	59	0.3600	0.0405	0.4576	3.11e-12	8e5t:s, 6em1:m, 6em3:B, 7nad:m, 7ohp:m, 7ohs:m, 7ohw:m, 7ohx:m, 7r6q:m, 7r72:m, 7r7a:m, 8v87:m
8	6elz:m	645	52	0.3467	0.0403	0.5000	3.97e-12	6em5:m, 7ohr:m, 7ohv:m
9	8v83:m	211	52	0.3467	0.1232	0.5000	3.97e-12	8v84:m
10	6cb1:s	512	60	0.3600	0.0527	0.4500	5.06e-12	6c0f:s
11	8fkp:SS	235	51	0.2400	0.0766	0.3529	1.35e-04	8fkq:SS, 8fkr:SS, 8fks:SS
12	8fky:SS	628	57	0.2533	0.0303	0.3333	3.45e-04	8fkt:SS, 8fku:SS, 8fkv:SS, 8fkw:SS, 8fkx:SS
13	4bif:A	131	18	0.1467	0.0840	0.6111	0.62	4bif:B, 4bif:C, 4bif:D, 4bif:E, 4bif:F, 4bif:G, 4bif:H, 8oz8:A, 8oz8:B, 8oz8:C, 8oz8:D, 4uxa:A, 4uxa:B, 4uxa:C, 4uxa:D, 4uxa:E, 4uxa:F, 4uxa:G, 4uxa:H, 4uxa:I, 4uxa:J, 4uxa:K, 4uxa:L, 4uxa:M, 4uxa:N, 4uxa:O, 4uxa:P, 4uxa:Q, 4uxa:R, 4uxa:S, 4uxa:T
14	8khv:A	579	44	0.2133	0.0276	0.3636	2.1
15	6hqv:A	1555	44	0.2000	0.0096	0.3409	2.6	6hqv:B

[Back]