EFPDYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHC
MTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISIN
NHISQEDCAKPAHH
The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5l73:A | 174 | 172 | 0.9885 | 0.9885 | 1.0000 | 2.98e-130 | 5l73:B |
2 | 4gwm:A | 561 | 125 | 0.2184 | 0.0677 | 0.3040 | 1.44e-09 | 7aq1:A, 7aq1:B, 7auw:A, 7auw:C, 4gwm:B, 4gwn:A |
3 | 7uac:H | 546 | 120 | 0.1954 | 0.0623 | 0.2833 | 8.49e-07 | 7uab:E, 7uab:H, 7uae:A, 7uaf:B, 7uaf:A, 7uaf:C, 7uaf:D, 7uai:E, 7uai:B, 7uai:C, 7uai:D |
4 | 7uab:A | 481 | 101 | 0.1667 | 0.0603 | 0.2871 | 0.003 | 7uab:D |
5 | 7y80:A | 1218 | 95 | 0.1609 | 0.0230 | 0.2947 | 0.025 | 8gu6:A |
6 | 7y82:A | 1341 | 95 | 0.1609 | 0.0209 | 0.2947 | 0.033 | |
7 | 7y8t:A | 1298 | 77 | 0.1264 | 0.0169 | 0.2857 | 0.79 | 8d9g:B, 7xsq:A, 7xsr:B, 7y8y:A |
8 | 8d8n:B | 1256 | 77 | 0.1264 | 0.0175 | 0.2857 | 0.82 | 8d9e:B, 8d9i:B, 7y81:A |
9 | 7xss:B | 1282 | 77 | 0.1264 | 0.0172 | 0.2857 | 0.86 | 8d9f:B, 8d9h:B, 7x8a:A, 7xso:A, 7xsp:B, 7xt4:B |
10 | 8gna:A | 1188 | 98 | 0.1494 | 0.0219 | 0.2653 | 1.0 | |
11 | 8d97:A | 1600 | 77 | 0.1264 | 0.0138 | 0.2857 | 1.2 | |
12 | 7y84:A | 1242 | 98 | 0.1494 | 0.0209 | 0.2653 | 1.3 | 7x7a:A, 7x7r:A, 7xc7:A, 7y83:A, 7y85:A |