EFMHVFDNNGIELKAECSIGEEDGVYGLILESWGPGDRNKDYNIALDYIIERLVDSGVSQVVVYLASSSVRKHMHSLDER
KIHPGEYFTLIGNSPRDIRLKMCGYQAYFSRTGRKEIPSGNRTKRILINVPGIYSDSFWASIIRG
The query sequence (length=145) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ghc:B | 286 | 145 | 1.0000 | 0.5070 | 1.0000 | 3.04e-105 | 6ghc:A, 6r64:A, 6r64:B, 6t21:A, 6t21:B, 6t22:A, 6t22:B |
2 | 5wzk:A | 513 | 56 | 0.1241 | 0.0351 | 0.3214 | 1.1 | |
3 | 5wzg:A | 534 | 56 | 0.1241 | 0.0337 | 0.3214 | 1.1 | 5wzh:A, 5wzi:A, 5wzj:A |
4 | 5c5c:A | 432 | 90 | 0.1931 | 0.0648 | 0.3111 | 1.3 | |
5 | 8a6t:B | 630 | 48 | 0.0966 | 0.0222 | 0.2917 | 1.4 | 8a6t:E, 8bew:B, 8bew:E |
6 | 7vob:C | 327 | 24 | 0.0759 | 0.0336 | 0.4583 | 2.9 | 7voc:C |
7 | 6eji:A | 360 | 72 | 0.1172 | 0.0472 | 0.2361 | 3.1 | 6eji:B, 6ejj:A, 6ejj:B, 6ejk:A, 6ejk:B |
8 | 1ne7:A | 281 | 22 | 0.0690 | 0.0356 | 0.4545 | 4.4 | 1ne7:B, 1ne7:C, 1ne7:E, 1ne7:F, 1ne7:D |
9 | 4kva:B | 258 | 76 | 0.1448 | 0.0814 | 0.2763 | 5.3 | 4kv9:A, 4kv9:B, 4kva:A |
10 | 6d73:A | 1227 | 52 | 0.0897 | 0.0106 | 0.2500 | 7.0 | 6d73:C, 6pkx:B, 6pkx:D |
11 | 2ze0:A | 531 | 32 | 0.0828 | 0.0226 | 0.3750 | 7.4 | |
12 | 6drj:A | 1266 | 52 | 0.0897 | 0.0103 | 0.2500 | 7.5 | 6d73:B, 6d73:D, 6drj:B, 6drj:C, 6drj:D |
13 | 6yw5:XX | 408 | 30 | 0.0759 | 0.0270 | 0.3667 | 7.6 | 6ywe:XX, 6ywx:XX, 6ywy:XX |
14 | 8c7f:A | 772 | 41 | 0.1034 | 0.0194 | 0.3659 | 7.6 | 7zb3:A, 7zb3:B, 7zdy:W, 7zdy:Y, 7zgz:Y |
15 | 7zgz:X | 753 | 41 | 0.1034 | 0.0199 | 0.3659 | 7.7 | 8c7f:B |
16 | 4v8m:Bh | 188 | 25 | 0.0690 | 0.0532 | 0.4000 | 9.5 | 8ova:Bh, 8ove:Bh |