EFKFLATEAKMLITAAERLAGTDPELQEMVALIKKELEQAERTFREAQRQLEFVLTAARAVMNVAAAANAAGTDPELIEM
VLRILKQLKEAIRTFQNGDQEEAETQLRFVLRAAIAVAVVAAALVLAGTDPELQEMVKQILEELKQAIETFARGDKEKAL
TQLLFVAWAAHAVAMIAAAANLAGTDPRLQQQVKEILEKLKEAIETFQKGDEEQAFRQLAEVLAEAALVALRAALTN
The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7uni:B | 245 | 242 | 1.0000 | 0.9673 | 0.9793 | 1.90e-160 | 7uni:A, 7uni:C, 7uni:D |
2 | 2f1k:A | 279 | 51 | 0.0717 | 0.0609 | 0.3333 | 0.56 | 2f1k:B, 2f1k:C, 2f1k:D |
3 | 6z2k:J | 157 | 59 | 0.0928 | 0.1401 | 0.3729 | 0.71 | |
4 | 7ue2:A | 304 | 159 | 0.2236 | 0.1743 | 0.3333 | 2.2 | |
5 | 4arz:A | 291 | 110 | 0.1055 | 0.0859 | 0.2273 | 4.1 | 6jwp:A, 6jwp:F, 3r7w:A, 3r7w:C |
6 | 4arz:A | 291 | 109 | 0.1097 | 0.0893 | 0.2385 | 4.8 | 6jwp:A, 6jwp:F, 3r7w:A, 3r7w:C |
7 | 7q4g:C | 231 | 48 | 0.0717 | 0.0736 | 0.3542 | 5.4 | 7q4f:A, 7q4f:B, 7q4f:C, 7q4f:D, 7q4f:E, 7q4g:A, 7q4g:B, 7q4g:D, 7q4g:E, 6xub:A, 6xub:B, 6xub:C, 6xub:D, 6xub:E, 6xuc:A, 6xuc:B, 6xuc:C, 6xuc:D, 6xuc:E |
8 | 5bq2:A | 425 | 132 | 0.1477 | 0.0824 | 0.2652 | 5.8 | 5bq2:B, 5bq2:C, 5bq2:D |
9 | 7khs:C | 427 | 45 | 0.0591 | 0.0328 | 0.3111 | 8.7 | |
10 | 2m0u:A | 117 | 53 | 0.0844 | 0.1709 | 0.3774 | 9.6 |