EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDES
The query sequence (length=43) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ki9:A | 43 | 43 | 1.0000 | 1.0000 | 1.0000 | 1.27e-26 | |
2 | 1qzu:A | 160 | 17 | 0.1860 | 0.0500 | 0.4706 | 2.1 | 1qzu:B, 1qzu:C, 1qzu:D |
3 | 3l2p:A | 535 | 15 | 0.1628 | 0.0131 | 0.4667 | 4.9 | |
4 | 1e20:A | 185 | 15 | 0.1628 | 0.0378 | 0.4667 | 8.9 | 1mvl:A, 1mvn:A |
5 | 3q9t:A | 577 | 12 | 0.1860 | 0.0139 | 0.6667 | 9.9 | 3q9t:B, 3q9t:C, 5zu2:A, 5zu2:B, 5zu2:C, 5zu3:A, 5zu3:B, 5zu3:C |