BioLiP

>protein
EESEKRKRVSSAVQFLHDSRVKITPAANKIQFLKSKGLTTEEVCEAFEKAGQTIPLDEIKK

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7qrc:B	61	61	1.0000	1.0000	1.0000	2.82e-39	7qrc:A
2	6s6r:A	69	60	0.6066	0.5362	0.6167	1.56e-21	5l87:A, 5l8a:A, 5l8a:B, 5l8a:C, 5l8a:D, 5n8v:A, 5n8v:B, 5n8v:D, 5n8v:F, 5oml:A, 5oml:D, 5oml:B, 5oml:C, 6rt2:A, 6rt2:D, 6rt2:B, 6rt2:C, 6s7m:A, 6s7m:B, 6s7m:C, 6s7m:D, 6s7m:H, 6s7m:E, 6spt:A
3	4bxu:A	69	43	0.3443	0.3043	0.4884	2.17e-09	2w84:A, 2w85:A
4	3ff5:A	54	42	0.3279	0.3704	0.4762	2.50e-08	3ff5:B
5	2qnw:A	80	43	0.2787	0.2125	0.3953	0.064
6	2o52:A	167	42	0.2951	0.1078	0.4286	0.12	2o52:B
7	7yjk:A	445	55	0.3279	0.0449	0.3636	0.24	7yjk:E, 7yjn:A, 7yjo:A
8	3ank:A	377	30	0.2459	0.0398	0.5000	0.58
9	2zzr:A	397	30	0.2459	0.0378	0.5000	0.58
10	2bme:A	176	42	0.2623	0.0909	0.3810	3.1	2bmd:A, 2bme:B, 2bme:C, 2bme:D, 1yu9:A, 1z0k:A, 1z0k:C
11	5zwn:U	583	28	0.1639	0.0172	0.3571	4.2	7oqc:D, 7oqe:D
12	3t6c:A	415	30	0.1803	0.0265	0.3667	4.8	3t6c:B
13	8hku:L141	86	49	0.2951	0.2093	0.3673	5.0	8hku:L142, 8hkv:L141, 8hkv:L142, 8hky:L141, 8hky:L142, 8hkz:L141, 8hkz:L142, 8hl1:L141, 8hl1:L142, 8hl2:L141, 8hl2:L142, 8hl3:L141, 8hl3:L142, 8hl4:L141, 8hl4:L142, 8hl5:L141, 8hl5:L142
14	5xbl:A	1320	25	0.1475	0.0068	0.3600	6.9
15	7mq8:LN	671	31	0.1967	0.0179	0.3871	8.3	7mq9:LN, 7mqa:LN

[Back]