EERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGKSMEGGDS
DEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQLEHH
The query sequence (length=131) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1p0z:A | 131 | 131 | 1.0000 | 1.0000 | 1.0000 | 1.33e-93 | 2j80:A, 2j80:B, 1p0z:B, 1p0z:C, 1p0z:D, 1p0z:E, 1p0z:F, 1p0z:G, 1p0z:H, 1p0z:I, 1p0z:J |
2 | 4onx:F | 129 | 109 | 0.2519 | 0.2558 | 0.3028 | 2.80e-09 | 4onx:A, 4onx:C, 4onx:B, 4onx:D, 4onx:E |
3 | 8w5z:A | 333 | 46 | 0.1374 | 0.0541 | 0.3913 | 0.79 | 8w5z:C |
4 | 2f9y:B | 257 | 48 | 0.1145 | 0.0584 | 0.3125 | 1.2 | |
5 | 5xnp:A | 361 | 53 | 0.0992 | 0.0360 | 0.2453 | 4.8 | 5xnp:B, 5xnq:A |
6 | 7xql:A | 444 | 37 | 0.1069 | 0.0315 | 0.3784 | 6.0 |