Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYETCTKIGSMWMSWCSLSPNYD
KDRAWKYC

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 1h8p:A 88 88 1.0000 1.0000 1.0000 2.71e-63 1h8p:B
2 1gxd:A 624 102 0.4091 0.0577 0.3529 1.87e-12 1ck7:A, 1eak:A, 1eak:B, 1eak:D, 1eak:C, 1gen:A, 1gxd:B, 1rtg:A
3 1gxd:A 624 102 0.3295 0.0465 0.2843 8.93e-08 1ck7:A, 1eak:A, 1eak:B, 1eak:D, 1eak:C, 1gen:A, 1gxd:B, 1rtg:A
4 1gxd:A 624 62 0.2727 0.0385 0.3871 8.33e-06 1ck7:A, 1eak:A, 1eak:B, 1eak:D, 1eak:C, 1gen:A, 1gxd:B, 1rtg:A
5 1l6j:A 405 100 0.4091 0.0889 0.3600 2.13e-12
6 1l6j:A 405 101 0.3636 0.0790 0.3168 5.22e-10
7 1l6j:A 405 49 0.2386 0.0519 0.4286 9.83e-07
8 1l6j:A 405 50 0.1591 0.0346 0.2800 1.3
9 3m7p:A 301 104 0.3864 0.1130 0.3269 7.36e-11
10 7prj:A 55 42 0.2045 0.3273 0.4286 3.47e-06
11 7prj:A 55 46 0.1932 0.3091 0.3696 0.18
12 5xts:A 460 72 0.2500 0.0478 0.3056 0.002 5xtw:A, 5xtw:C, 5xtw:D, 5xtw:E, 5xtw:F, 5xtw:H
13 5xts:A 460 33 0.1477 0.0283 0.3939 1.4 5xtw:A, 5xtw:C, 5xtw:D, 5xtw:E, 5xtw:F, 5xtw:H
14 5e4l:A 428 42 0.1591 0.0327 0.3333 0.026
15 5e4l:A 428 42 0.1705 0.0350 0.3571 7.2
16 5e4l:B 386 42 0.1591 0.0363 0.3333 0.031
17 5e4l:B 386 42 0.1705 0.0389 0.3571 8.4
18 5e4k:A 424 42 0.1591 0.0330 0.3333 0.10
19 6bvg:A 447 50 0.1932 0.0380 0.3400 0.67 6bvg:B, 5iws:A
20 3qf7:A 357 37 0.1705 0.0420 0.4054 3.5 3qf7:B, 3tho:A, 4w9m:C, 4w9m:I, 4w9m:E, 4w9m:K
21 4dy7:F 378 43 0.1591 0.0370 0.3256 5.5
22 8jx6:B 451 91 0.2273 0.0443 0.2198 6.3
23 4adb:B 401 30 0.1364 0.0299 0.4000 9.7 4adb:A, 4adb:C, 4adb:D, 4adc:A, 4adc:B, 4adc:C, 4adc:D, 4add:A, 4add:B, 4add:C, 4add:D

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417