BioLiP

>protein
EEACELPECQEDAGNKVCSLQCNNHACGWDGGDCS

The query sequence (length=35) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1pb5:A	35	35	1.0000	1.0000	1.0000	9.32e-20
2	7abv:A	232	33	0.8857	0.1336	0.9394	2.97e-16	3eto:A, 3eto:B, 3i08:A, 3i08:C, 3l95:X, 3l95:Y
3	4zlp:A	241	32	0.4571	0.0664	0.5000	5.85e-05	5czv:A, 5czx:A, 5czx:B, 6xsw:C, 6xsw:F, 6xsw:J, 6xsw:X, 4zlp:B
4	4zlp:A	241	27	0.3143	0.0456	0.4074	0.66	5czv:A, 5czx:A, 5czx:B, 6xsw:C, 6xsw:F, 6xsw:J, 6xsw:X, 4zlp:B
5	2oo4:A	226	27	0.4571	0.0708	0.5926	1.87e-04	2oo4:B
6	2oo4:A	226	27	0.3143	0.0487	0.4074	1.1	2oo4:B
7	4gz8:A	557	33	0.3429	0.0215	0.3636	1.2	4gz8:B
8	6otf:B	521	17	0.2571	0.0173	0.5294	2.2	6otf:A, 6otf:C, 6ouc:A
9	8hgg:C	1484	28	0.2857	0.0067	0.3571	3.1	8hgg:D, 8hgh:A, 8hgh:B
10	8hgg:C	1484	26	0.2857	0.0067	0.3846	5.5	8hgg:D, 8hgh:A, 8hgh:B
11	8hgg:C	1484	21	0.2857	0.0067	0.4762	5.8	8hgg:D, 8hgh:A, 8hgh:B
12	8a7e:C	1524	28	0.2857	0.0066	0.3571	3.1	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
13	8a7e:C	1524	26	0.2857	0.0066	0.3846	5.4	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
14	8a7e:C	1524	21	0.2857	0.0066	0.4762	5.6	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
15	5xtg:B	233	29	0.3143	0.0472	0.3793	5.1
16	5z34:A	361	15	0.2286	0.0222	0.5333	6.0
17	8a7d:Q	273	26	0.2857	0.0366	0.3846	7.0

[Back]