EDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDK
The query sequence (length=42) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2c6a:A | 46 | 42 | 1.0000 | 0.9130 | 1.0000 | 2.42e-26 | 2c6b:A, 4xxb:B |
2 | 2cr8:A | 53 | 32 | 0.3571 | 0.2830 | 0.4688 | 8.87e-07 | |
3 | 3irb:A | 137 | 31 | 0.2381 | 0.0730 | 0.3226 | 0.40 | 3irb:B |
4 | 1nj3:A | 31 | 25 | 0.2381 | 0.3226 | 0.4000 | 0.47 | 1q5w:A |
5 | 5m60:A | 755 | 33 | 0.2857 | 0.0159 | 0.3636 | 0.75 | |
6 | 8hfc:A | 276 | 18 | 0.2143 | 0.0326 | 0.5000 | 0.88 | |
7 | 7yet:A | 999 | 23 | 0.1905 | 0.0080 | 0.3478 | 1.8 | |
8 | 8hf3:A | 295 | 18 | 0.1905 | 0.0271 | 0.4444 | 1.9 | |
9 | 7yes:A | 1369 | 23 | 0.1905 | 0.0058 | 0.3478 | 2.2 | 8jsl:A, 8jsm:A, 8jsn:A, 7yer:A |
10 | 2ayj:A | 56 | 34 | 0.2619 | 0.1964 | 0.3235 | 2.7 | |
11 | 3a9j:C | 32 | 24 | 0.1905 | 0.2500 | 0.3333 | 4.1 | 9avt:C, 9avw:C, 7e62:C, 7e62:J, 2wwz:C, 2wx0:C, 2wx0:G, 2wx1:C |
12 | 7ajt:UM | 762 | 27 | 0.2857 | 0.0157 | 0.4444 | 4.5 | 7aju:UM, 7d4i:B3, 7d5s:B3, 7d5t:B3, 7d63:B3, 6ke6:B3, 6lqp:B3, 6lqq:B3, 6lqr:B3, 6lqs:B3, 6lqt:B3, 6lqu:B3, 6lqv:B3, 7suk:LR, 6zqa:UM, 6zqb:UM, 6zqc:UM, 6zqd:UM, 6zqf:UM |
13 | 5wyj:BC | 783 | 27 | 0.2857 | 0.0153 | 0.4444 | 5.7 | 5wyk:BC |
14 | 2k1p:A | 33 | 25 | 0.2381 | 0.3030 | 0.4000 | 5.7 | |
15 | 2vr0:F | 146 | 29 | 0.2857 | 0.0822 | 0.4138 | 7.7 | 2j7a:C, 2j7a:F, 2j7a:I, 2j7a:L, 2j7a:O, 2j7a:R, 2vr0:C |
16 | 1qo8:A | 564 | 29 | 0.2381 | 0.0177 | 0.3448 | 9.8 | 1qo8:D |