BioLiP

>protein
EDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLSKRWDLWRKIVTS
DLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDLNKQMVEFLQAAGLSLGHNDPAD
FVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAEILDLSNDYARRSYANIKEKLFSLGCTEEEVQK
FVLSYPDVIALAEKKFNDKIDCLMEENISISQIIENPRVLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKL
KKLS

The query sequence (length=324) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3n6s:A	344	324	0.9969	0.9390	0.9969	0.0	5cky:O, 5co0:O, 5crj:O, 5crk:O, 3mva:O, 3mvb:O, 3n7q:A
2	1wdl:A	715	51	0.0432	0.0196	0.2745	0.23	2d3t:A, 2d3t:B, 1wdk:A, 1wdk:B, 1wdl:B, 1wdm:A, 1wdm:B
3	8pmj:A	1133	127	0.0833	0.0238	0.2126	1.1	8pmd:A
4	7dv5:U	1189	127	0.0833	0.0227	0.2126	1.2	7e1a:U
5	5a0y:E	442	64	0.0494	0.0362	0.2500	1.5	5a0y:B, 5a8k:B, 5a8k:E, 7b2h:B, 7b2h:E, 5g0r:E, 5g0r:B, 1hbm:B, 1hbm:E, 1hbn:B, 1hbn:E, 1hbo:B, 1hbo:E, 1hbu:B, 1hbu:E, 3m1v:E, 3m1v:B, 3m2r:E, 3m2r:B, 3m2u:E, 3m2u:B, 3m2v:E, 3m2v:B, 3m30:E, 3m30:B, 3m32:B, 3m32:E, 1mro:E, 1mro:B, 3pot:E, 3pot:B, 7suc:b, 7suc:B, 7sxm:E, 7sxm:B
6	1jl3:A	137	64	0.0556	0.1314	0.2812	2.5	1jl3:B, 1jl3:C, 1jl3:D
7	4iug:A	957	50	0.0494	0.0167	0.3200	4.1
8	6z1p:BY	327	137	0.0988	0.0979	0.2336	5.0
9	2zjs:Y	415	109	0.0895	0.0699	0.2661	5.0
10	1wkk:A	137	46	0.0494	0.1168	0.3478	5.8	1wkl:A, 1wkl:B
11	8pm6:A	872	128	0.0833	0.0310	0.2109	9.9

[Back]