ECHLSDLLQQLTSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDS
The query sequence (length=223) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
4o56:A |
244 |
223 |
0.9686 |
0.8852 |
0.9686 |
1.71e-164 |
6ax4:A, 3bzi:A, 3c5l:A, 8crc:A, 4dfw:A, 5dms:A, 5dms:C, 5dmv:C, 5dnj:A, 4e67:A, 4e9c:A, 4e9d:A, 3fvh:A, 6gy2:B, 6gy2:A, 4h71:A, 4hab:A, 4hab:B, 4hab:C, 4hco:A, 3hik:A, 4hy2:A, 5j19:B, 5j19:A, 8joq:A, 8joy:A, 4lkl:A, 4lkm:A, 4lkm:C, 7mso:A, 7mso:B, 7mx1:A, 7mx1:B, 5nei:A, 5nfu:A, 5nje:A, 5nmm:A, 5nn2:A, 4o6w:A, 4o9w:A, 2ojx:A, 3p2z:A, 3p34:A, 3p35:A, 3p35:B, 3p36:A, 3p37:A, 3p37:B, 3p37:C, 3q1i:A, 1q4k:A, 1q4k:B, 1q4k:C, 4rcp:A, 3rq7:A, 8s30:A, 8s31:A, 8s31:B, 1umw:A, 1umw:B, 8wfp:A, 8wfp:B, 4whh:A, 4whk:A, 4whl:A, 5x3s:B, 5x3s:A, 4x9r:A, 4x9v:A, 4x9w:A |
2 |
6mf5:B |
262 |
206 |
0.2825 |
0.2405 |
0.3058 |
1.49e-22 |
6mf4:A, 6mf5:A, 6mf6:B, 6mf6:A |
3 |
6ogz:A |
1082 |
77 |
0.1031 |
0.0213 |
0.2987 |
0.17 |
6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B |
4 |
6qm5:A |
673 |
77 |
0.1031 |
0.0342 |
0.2987 |
1.1 |
6qm5:B, 6qm9:A, 6qm9:B, 6qma:A, 6qma:B, 6qmb:A, 6qmb:B, 8toi:A, 8toi:B, 8tok:A, 8tok:B, 8tol:A, 8tol:B, 4wis:A, 4wis:B, 4wit:A, 4wit:B |
5 |
3c8f:A |
245 |
107 |
0.1031 |
0.0939 |
0.2150 |
2.1 |
3cb8:A, 8fo0:A, 8fol:A, 8fsi:A |
6 |
6oy3:B |
594 |
31 |
0.0493 |
0.0185 |
0.3548 |
2.9 |
6oy3:A, 8tpn:A, 8tpn:B, 8tpq:A, 8tpq:B, 8tps:A, 8tps:B, 8tpt:A |
7 |
8tpm:B |
615 |
31 |
0.0493 |
0.0179 |
0.3548 |
3.5 |
8tpm:A, 8tpo:B, 8tpo:A, 8tpp:A, 8tpp:B, 8tpr:A, 8tpr:B |
8 |
8tpt:B |
571 |
31 |
0.0493 |
0.0193 |
0.3548 |
3.7 |
|
9 |
7esa:A |
322 |
147 |
0.1345 |
0.0932 |
0.2041 |
4.7 |
7esb:A, 7esc:A, 7f2u:A, 7f2u:B |
10 |
7anv:A |
467 |
143 |
0.1525 |
0.0728 |
0.2378 |
8.7 |
|