DWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVWGGMSEDERRALKR
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5oay:A | 76 | 72 | 1.0000 | 0.9474 | 1.0000 | 2.48e-50 | 6ono:A, 6ono:C, 6onu:A, 6onu:C, 6onu:E, 6onu:G |
2 | 8dy7:H | 85 | 71 | 0.4306 | 0.3647 | 0.4366 | 3.33e-15 | 8dy9:H |
3 | 8cwr:A | 85 | 72 | 0.4583 | 0.3882 | 0.4583 | 1.35e-13 | 8cwt:A, 8cwt:C, 8cwt:E, 8cyf:A |
4 | 7kim:Z | 80 | 59 | 0.2917 | 0.2625 | 0.3559 | 2.52e-05 | 7kif:Z, 7kuf:A, 7kug:A, 7kug:C |
5 | 8ssl:A | 1072 | 25 | 0.1389 | 0.0093 | 0.4000 | 1.5 | 5cjt:A, 5cjt:B, 5cju:A, 5cju:B, 5cjv:A, 5cjv:B, 5cjw:A, 5cjw:B, 8ssl:B, 8ssl:C, 4xc6:A, 4xc6:B, 4xc7:A, 4xc8:A, 4xc8:B |
6 | 2bvf:A | 453 | 51 | 0.1806 | 0.0287 | 0.2549 | 2.5 | 2bvf:B, 2bvg:A, 2bvg:B, 2bvg:C, 2bvg:D, 2bvh:A, 2bvh:B, 2bvh:C, 2bvh:D |
7 | 4hr3:A | 407 | 47 | 0.1944 | 0.0344 | 0.2979 | 4.9 |