BioLiP

>protein
DVITVYKDCNYTGFSGGLTIGDYNLARLNSLGVLNDDISSLRITQGYQAILYQDDNFGGASTVINSDNSCLNTTWNDKVS
SIRVIANG

The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3hzb:D	90	88	1.0000	0.9778	1.0000	1.41e-58	3hzb:A, 3hzb:B, 3hzb:C, 3hzb:E, 3hzb:F, 3hzb:G, 3hzb:H
2	3so1:H	89	85	0.3523	0.3483	0.3647	1.56e-15	5ht8:A, 3i9h:A, 3i9h:B, 3i9h:C, 3i9h:D, 3i9h:E, 3i9h:F, 3i9h:G, 3i9h:H, 3iaj:A, 3sny:A, 3snz:A, 3so0:A, 3so0:B, 3so0:C, 3so0:D, 3so0:E, 3so0:F, 3so0:G, 3so1:A, 3so1:B, 3so1:C, 3so1:D, 3so1:E, 3so1:F, 3so1:G
3	1prr:A	173	84	0.3750	0.1908	0.3929	2.10e-12	1nps:A, 1prs:A
4	1prr:A	173	79	0.3295	0.1676	0.3671	1.01e-07	1nps:A, 1prs:A
5	1hdf:A	100	85	0.2727	0.2400	0.2824	0.005	1hdf:B
6	2k1w:A	85	37	0.1818	0.1882	0.4324	0.019	5ht9:A, 5ht9:B, 3hz2:A, 3hz2:B, 3hz2:C, 3hz2:D
7	4dzh:A	439	29	0.1364	0.0273	0.4138	2.3
8	1hl7:A	279	21	0.1136	0.0358	0.4762	5.0	1hl7:B
9	2bv2:A	83	38	0.1818	0.1928	0.4211	5.8	2bv2:B
10	3ci0:K	280	17	0.1136	0.0357	0.5882	6.6
11	8xha:A	401	81	0.2727	0.0599	0.2963	9.7	8i7u:C, 8i7u:F, 8i7u:A, 8i7u:E, 8i7u:B, 8i7u:D, 8xha:B, 8xhd:A, 8xhd:B, 8xhk:C, 8xhk:A, 8xhk:B, 8xhk:E, 8xhk:D, 8xhk:F

[Back]