BioLiP

>protein
DTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQR

The query sequence (length=46) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2wtt:L	46	46	1.0000	1.0000	1.0000	5.26e-27	2wqj:K, 2wqj:Z, 2wtt:N, 2wtt:O, 2wtt:P
2	2wqj:C	32	28	0.6087	0.8750	1.0000	8.31e-14
3	4d1l:F	38	35	0.4130	0.5000	0.5429	4.52e-07	4cz5:C, 4cz6:D
4	7bwn:J	280	25	0.2609	0.0429	0.4800	0.13	7bwn:O, 7bwn:C, 7bwn:M, 4gf6:B, 4w74:A, 4w74:B, 4w74:H, 4w74:C, 4w74:D, 4w74:E, 4w76:A, 4w76:B, 4w77:A, 4w77:B, 4w7a:A, 4w7a:B, 4w7c:B, 4w7d:A, 4w7f:A, 4w7r:A, 4w7r:B, 4w7r:C, 4w7r:D
5	4mzr:A	234	25	0.2609	0.0513	0.4800	0.32	4mzr:B, 4mzr:C, 4mzr:D, 3q01:A, 3q01:B, 3q05:A, 3q05:C, 3q05:B, 3q05:D, 3q06:A, 3q06:C, 3q06:D, 3q06:B, 3ts8:A, 3ts8:B, 3ts8:C, 3ts8:D
6	8jbw:A	364	61	0.4130	0.0522	0.3115	0.72
7	8ka5:A	297	35	0.2826	0.0438	0.3714	1.3	8ka3:A, 8ka4:B, 8ka4:C
8	7pwd:A	621	42	0.3261	0.0242	0.3571	2.7	6c2y:A, 3cik:A, 5he1:A, 7k7l:A, 3krw:A, 3krx:A, 3pvu:A, 3pvw:A, 5ukk:A, 5wg3:A, 5wg5:A
9	3uzs:A	609	42	0.3261	0.0246	0.3571	3.6	3uzt:A
10	1rj5:A	259	32	0.3478	0.0618	0.5000	3.8	1rj5:B, 1rj6:A, 1rj6:B
11	1m1j:B	402	32	0.2609	0.0299	0.3750	3.9	1m1j:E
12	8cbj:l	286	34	0.1957	0.0315	0.2647	4.0	6eml:r, 6fai:l, 6rbd:l, 6y7c:l
13	2cd9:A	363	30	0.1957	0.0248	0.3000	5.6	2cd9:B, 2cda:A, 2cda:B, 2cdb:A, 2cdb:B, 2cdb:C, 2cdb:D, 2cdc:A, 2cdc:B, 2cdc:C, 2cdc:D

[Back]