DTVIDEKINIPVPLGTVFSLLYGDDTSYIKKIIENQNNFNVCDIPKFVNNAREITYTKKLNNSFGPKQTKCIVTETIEHM
DLNSFFMVKQIVRSPDVPYGSSFSVHTRFFYSWGDHNTTNMKVVTNVVWTGKSMLKGTIEKGSIDGQRSSTKQLVDDLKK
IISN
The query sequence (length=164) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ys0:B | 164 | 164 | 1.0000 | 1.0000 | 1.0000 | 2.33e-120 | 5ys0:A |
2 | 6bym:A | 200 | 169 | 0.5427 | 0.4450 | 0.5266 | 1.10e-61 | 6bym:B |
3 | 6cay:A | 165 | 157 | 0.4390 | 0.4364 | 0.4586 | 1.00e-46 | 6cay:B |
4 | 7azn:A | 177 | 149 | 0.2317 | 0.2147 | 0.2550 | 9.05e-05 | 8axw:A |
5 | 6gqf:A | 168 | 115 | 0.1707 | 0.1667 | 0.2435 | 0.008 | 6gqf:B, 6gqf:C, 6gqf:D |
6 | 8ci5:A | 1258 | 62 | 0.0915 | 0.0119 | 0.2419 | 0.47 | |
7 | 7lld:A | 446 | 80 | 0.1220 | 0.0448 | 0.2500 | 2.5 | 7lld:B, 7lle:A, 7lle:B |
8 | 6czy:A | 362 | 24 | 0.0732 | 0.0331 | 0.5000 | 6.1 | 6czy:B, 6czy:C, 6czy:D, 6czz:A, 6czz:B, 6czz:C, 6czz:D |
9 | 3gqc:B | 440 | 56 | 0.0915 | 0.0341 | 0.2679 | 7.1 | 3gqc:A, 3gqc:D, 3gqc:C |
10 | 2uvh:A | 404 | 37 | 0.0854 | 0.0347 | 0.3784 | 8.5 | 2uvi:A, 2uvj:A |
11 | 5g09:D | 473 | 22 | 0.0427 | 0.0148 | 0.3182 | 9.2 | 5g09:A, 5g09:B, 5g09:C, 5g0a:A, 5g0a:B, 5g0a:C, 5g0a:D, 5g2p:A, 5g2p:B, 5g2p:C, 5g2p:D, 5g2q:A, 5g2q:B, 5g2q:C, 5g2q:D, 5g2q:E, 5g2q:F, 5g2q:G, 5g2q:H, 5g2q:I, 5g2q:J, 5g2q:K, 5g2q:L |