Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP Library
>protein
DTAILYPFTISGNDRNGNFTINFKGTPNSTNNGCIGYSYNGDWEKIEWEGSCDGNGNLVVEVPMSKIPAGVTSGEIQIWW
HSGDLKMTDYKALE

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 5fu3:B 99 93 0.9894 0.9394 1.0000 3.69e-66 5fu2:A, 5fu2:B, 5fu3:A, 5fu4:A, 5fu4:B
2 5mol:B 322 32 0.1277 0.0373 0.3750 0.52 6eyo:A, 4ezm:C, 4gko:C, 4j4p:A, 5moi:B, 5moi:D, 5mok:D, 5mol:A, 7mxi:B, 5nqw:A, 1o0v:A, 1o0v:B, 7shy:A, 7shy:B, 7shz:B, 7si0:B, 7si0:H
3 7onj:A 262 82 0.2128 0.0763 0.2439 0.99 7onj:B, 7onj:G, 7onj:C, 7onj:D, 7onj:E, 7onj:F, 7ooa:A, 7ooa:B, 7ooa:G, 7ooa:C, 7ooa:D, 7ooa:E, 7ooa:F
4 3u4e:L 214 72 0.2128 0.0935 0.2778 2.3 8fk5:L
5 8hfd:A 452 48 0.1277 0.0265 0.2500 6.4 3e74:B, 8hfd:B, 8hfd:C, 8hfd:D
6 2j07:A 419 14 0.0851 0.0191 0.5714 8.9 1iqr:A, 1iqu:A, 2j08:A, 2j09:A
7 3a3e:B 433 61 0.1915 0.0416 0.2951 9.2

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417