BioLiP

>protein
DTAHGVGEIPMKTDLELDFSLPSSSSYSYRRKLTNPANKEESIPFHFQMEKQVIHAEIQPLGHWMDATFNIKTAFHCYGA
CQKYSYPWQTSKCFFEKDYQYETGWGCNPGDCPGVGTGCTACGVYLDKLKSVGKAYKIISLKYTRKVCIQLGTEQTCKHI
DANDCLVTPSVKVCIVGTVSKLQPSDTLLFLGPLEQGGIILKQWCTTSCAFGDPGDIMSTPSGMRCPEHTGSFRKICGFA
TTPVCEYQGNTISGYKRMMATKDSFQSFNLTEPHITTNKLEWIDPDGNTRDFVNLVLNRDVSFQDLSDNPCKVDLHTQAI
EGAWGSGVGFTLTCTVGLTECPSFMTSIKACDLAMCYGSTVTNLARGSNTVKVVGKGGHSGSSFKCCHDTDCSSEGLLAS
ADKVYDDGAPPCTFKCW

The query sequence (length=417) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6y62:B	419	410	0.9185	0.9141	0.9341	0.0	6y5f:B, 6zjm:F, 6zjm:H, 6zjm:D, 6zjm:B
2	7qqb:B	423	412	0.7578	0.7470	0.7670	0.0
3	5ljz:A	410	402	0.6211	0.6317	0.6443	0.0	5lk1:A
4	5ljx:A	382	402	0.5755	0.6283	0.5970	4.81e-177	5lk2:A, 5lk3:A
5	1yqq:A	273	39	0.0312	0.0476	0.3333	7.3	1yqq:B, 1yqq:C, 1yqu:A, 1yqu:B, 1yqu:C, 1yr3:A, 1yr3:B, 1yr3:C, 1yr3:D, 1yr3:E, 1yr3:F
6	5aj4:Bh	289	29	0.0360	0.0519	0.5172	7.7	4ce4:h, 6gaw:Bh, 6gb2:Bh, 7nqh:Bh, 7nql:Bh, 7nsh:Bh, 7nsi:Bh, 7nsj:Bh, 8oin:Bt, 8oiq:Bt, 7qh7:c, 6ydp:Bh, 6ydw:Bh
7	1h30:A	391	139	0.0719	0.0767	0.2158	8.3	2c5d:A, 2c5d:B, 4ra0:A, 4ra0:B, 5vxz:A, 5vxz:B
8	7jw4:A	591	95	0.0600	0.0423	0.2632	9.1	7jw4:B, 7jwf:A, 7jwf:B, 7jwf:C, 7jwf:D
9	1yge:A	839	39	0.0408	0.0203	0.4359	9.7	3bnb:A, 3bnc:A, 3bnd:A, 3bne:A, 5eeo:A, 1f8n:A, 1fgm:A, 1fgo:A, 1fgq:A, 1fgr:A, 1fgt:A, 3pzw:A, 2sbl:B, 2sbl:A, 7soi:A, 7soi:B, 7soj:A, 7soj:B, 5t5v:A, 5t5v:B, 5tqn:A, 5tqn:B, 5tqo:A, 5tqo:B, 5tqp:A, 5tqp:B, 5tr0:A, 5tr0:B, 4wfo:A, 4wha:A, 1y4k:A

[Back]