DRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLK
VYLQRF
The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6r2v:B | 93 | 86 | 1.0000 | 0.9247 | 1.0000 | 5.13e-61 | 7cvo:B, 7cvq:B, 7cvq:G, 7cvq:L, 7cvq:Q |
2 | 7c9o:B | 85 | 84 | 0.8721 | 0.8824 | 0.8929 | 4.51e-53 | |
3 | 7aw7:B | 92 | 86 | 0.7326 | 0.6848 | 0.7326 | 5.37e-46 | 7aw9:B, 4g91:B, 4g92:B, 6y35:B, 6y36:B, 6y37:B, 6y39:B, 6y39:E, 6y39:H |
4 | 4awl:B | 92 | 86 | 0.7093 | 0.6630 | 0.7093 | 1.09e-44 | 7ah8:A, 7ah8:C, 6qmp:B, 6qmq:B, 6qms:B, 8qu2:B, 8qu3:B, 8qu4:B |
5 | 1jfi:B | 135 | 84 | 0.3372 | 0.2148 | 0.3452 | 8.17e-16 | |
6 | 4wzs:B | 113 | 74 | 0.3023 | 0.2301 | 0.3514 | 1.68e-09 | |
7 | 1a7w:A | 68 | 64 | 0.2442 | 0.3088 | 0.3281 | 5.26e-04 | 5t5k:A, 5t5k:B, 5t5k:C, 5t5k:D, 5t5k:E, 5t5k:F |
8 | 8epm:A | 991 | 47 | 0.1395 | 0.0121 | 0.2553 | 0.037 | |
9 | 7xlq:A | 1319 | 47 | 0.1395 | 0.0091 | 0.2553 | 0.065 | 8epl:A, 7yg5:A |
10 | 6qmq:C | 84 | 74 | 0.2558 | 0.2619 | 0.2973 | 0.069 | 7ah8:B, 7ah8:D, 4awl:C, 6qmp:C, 6qms:C, 8qu2:C, 8qu3:C, 8qu4:C |
11 | 7aw9:C | 118 | 73 | 0.2326 | 0.1695 | 0.2740 | 0.39 | 7aw7:C, 4g91:C, 4g92:C, 6y35:C, 6y36:C, 6y37:C, 6y39:C, 6y39:F, 6y39:I |
12 | 7vfs:A | 1266 | 47 | 0.1279 | 0.0087 | 0.2340 | 0.85 | 7vfu:A, 7vfv:A, 7vfw:A |
13 | 7mix:A | 1326 | 47 | 0.1279 | 0.0083 | 0.2340 | 0.89 | 7miy:A |
14 | 8x90:A | 1377 | 47 | 0.1279 | 0.0080 | 0.2340 | 1.6 | 8x91:A, 8x93:A |
15 | 2x6b:A | 287 | 63 | 0.1744 | 0.0523 | 0.2381 | 3.5 | 7n9k:A, 7n9l:A, 6o9t:A, 6o9u:A, 6o9v:A, 6o9v:B, 2x6a:A, 2x6c:A |
16 | 4m54:A | 310 | 25 | 0.1279 | 0.0355 | 0.4400 | 4.7 | |
17 | 4mp6:A | 334 | 25 | 0.1279 | 0.0329 | 0.4400 | 5.6 | 4mp8:A, 4mpd:A |
18 | 6en3:A | 934 | 68 | 0.2209 | 0.0203 | 0.2794 | 6.8 | 8a49:C, 4nuy:A, 4nuz:A |
19 | 6px9:B | 207 | 52 | 0.1628 | 0.0676 | 0.2692 | 6.9 | |
20 | 5coc:A | 124 | 55 | 0.2209 | 0.1532 | 0.3455 | 7.6 | |
21 | 1okg:A | 362 | 75 | 0.2209 | 0.0525 | 0.2533 | 9.3 |