DPFTKTSLYESTLKNQTDLLKVTQSTVEDFRSTNQSFTRALEKDIANLPYQSLITEENIINNVGPILKYYRHSINALNVY
LGLNNGKVLLSQKSAKMPELRDDLDIKTKDWYQEALKTNDIFVTPAYLDTVLKQYVITYSKAIYKDGKIIGVLGVDIPSE
DLQNLVAKTPGNTFLFDQKNKIFAATNKELLNPSIDHSPVLNAYKLNGDNNFFSYKLNNEERLGACTKVFAYTACITESA
DIINK
The query sequence (length=245) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6w3o:B | 252 | 245 | 1.0000 | 0.9722 | 1.0000 | 0.0 | 6w3o:A, 6w3p:A, 6w3p:B, 6w3r:A, 6w3r:B, 6w3s:A, 6w3s:B, 6w3t:A, 6w3t:B, 6w3v:A, 6w3v:B, 6w3x:A, 6w3x:B, 6w3y:A, 6w3y:B, 4xmr:A, 4xmr:B |
2 | 6py3:B | 238 | 120 | 0.1510 | 0.1555 | 0.3083 | 7.53e-09 | 6pxy:A, 6py3:A, 6py4:A, 6py5:A, 6pyi:A, 6q0f:A, 6q0g:A |
3 | 5ltx:A | 243 | 154 | 0.1469 | 0.1481 | 0.2338 | 3.14e-06 | 5ltx:B, 5t65:A, 5t65:B, 5t7m:A, 5t7m:B |
4 | 5lt9:B | 253 | 160 | 0.1510 | 0.1462 | 0.2313 | 0.002 | 5lt9:A, 5lto:A, 5lto:B |
5 | 6d8v:A | 269 | 97 | 0.1265 | 0.1152 | 0.3196 | 0.002 | |
6 | 6f9g:D | 262 | 67 | 0.1020 | 0.0954 | 0.3731 | 0.004 | 6f9g:A, 6f9g:B, 6f9g:C, 6f9g:E |
7 | 6fu4:A | 297 | 74 | 0.0980 | 0.0808 | 0.3243 | 0.015 | 6fu4:B, 6fu4:C, 6fu4:D |
8 | 6ior:A | 241 | 64 | 0.0694 | 0.0705 | 0.2656 | 0.79 | 6iop:A, 6iop:B, 6ioq:A, 6ior:B, 6ior:C, 6ior:D, 6ios:A, 6iot:A, 6iot:B, 6iot:C, 6iot:D, 6iou:A, 6iou:B |
9 | 1l1q:A | 181 | 61 | 0.0898 | 0.1215 | 0.3607 | 1.0 | 1l1r:A |
10 | 8bmv:B | 249 | 83 | 0.0898 | 0.0884 | 0.2651 | 1.0 | 8bmv:A |
11 | 5ave:A | 252 | 93 | 0.0816 | 0.0794 | 0.2151 | 1.4 | 5avf:A, 5avf:B, 3c8c:A, 3c8c:B, 6iov:A, 6iov:B |
12 | 2o2c:A | 564 | 120 | 0.1143 | 0.0496 | 0.2333 | 2.2 | 2o2c:B, 2o2c:C |
13 | 3fid:A | 296 | 88 | 0.1061 | 0.0878 | 0.2955 | 3.6 | 3fid:B |
14 | 3ksg:A | 153 | 19 | 0.0490 | 0.0784 | 0.6316 | 5.7 | 3ksg:B |
15 | 8x90:B | 964 | 113 | 0.1143 | 0.0290 | 0.2478 | 8.3 | 8e59:D, 8e5a:D, 8e5b:D, 8epl:C, 8epm:C, 8fhs:D, 7mix:D, 7miy:D, 7uhf:D, 7uhg:D, 8we6:D, 8we7:D, 8we8:D, 8we9:D, 8wea:D, 8x91:B, 8x93:B |
16 | 6l7x:A | 203 | 31 | 0.0531 | 0.0640 | 0.4194 | 8.5 | 6l7w:A, 6l7y:A |
17 | 7oyl:A | 557 | 75 | 0.0816 | 0.0359 | 0.2667 | 9.4 | |
18 | 6e0a:B | 262 | 58 | 0.0653 | 0.0611 | 0.2759 | 9.5 | 6e0a:A |
19 | 8e56:F | 973 | 113 | 0.1143 | 0.0288 | 0.2478 | 9.7 | 8e57:F, 8e58:F, 8eog:D, 8fd7:D, 5gjw:F, 6jp5:F, 6jpa:F, 6jpb:F, 7vfs:B, 7vfu:B, 7vfv:B, 7vfw:B, 7xlq:D, 7yg5:D |