BioLiP

>protein
DNPWLDARVLNMAHAGGENEAPANTLYAFKRAVKLGANMLELDVQSTKDDQLVVIHNATVDQTTDGTGKVRDLTFEQVHE
LDAAYNFIPGRHAVPGEPPESYPLRGVRTGEKKPPPGYQPSDFAIPKLADVLEAFPRTPINIEIKGTSDADIPSFLHNAK
LLARLLKKTGRTDFIVTSLNDLAVAKFHLLAPDIPIAPGMAGLAAYFLLGVKPMHGTVALQIPVRYQGLEIATPEFIRRA
HADGYAVHVWFSGTAPDDEATYNRIIDSCADGLMPAYPALLERILDERGIERPGRPGVDPC

The query sequence (length=301) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7ym0:A	301	301	0.9967	0.9967	0.9967	0.0	7ym0:B, 7ymr:A, 7ymr:B, 7ymr:C, 7ymr:D
2	2pz0:B	243	287	0.2757	0.3416	0.2892	7.13e-23	2pz0:A
3	5t9c:E	263	288	0.2724	0.3118	0.2847	4.17e-22	5t91:A, 5t9b:G
4	4r7o:C	280	196	0.1927	0.2071	0.2959	4.63e-18	4r7o:A, 4r7o:B, 4r7o:D, 4r7o:E, 4r7o:F, 4r7o:G
5	8ghh:A	276	236	0.2259	0.2464	0.2881	1.50e-17	8ghi:A
6	4oec:A	248	143	0.1561	0.1895	0.3287	1.53e-15	4oec:B, 4oec:C, 4oec:D
7	2oog:D	268	200	0.1860	0.2090	0.2800	2.47e-13	2oog:A, 2oog:B, 2oog:C, 2oog:E, 2oog:F
8	7e2b:A	253	80	0.0764	0.0909	0.2875	1.09e-09
9	5vug:A	268	147	0.1362	0.1530	0.2789	1.00e-06
10	3l12:A	297	309	0.2458	0.2492	0.2395	7.29e-06	3l12:B
11	3qvq:A	251	72	0.0797	0.0956	0.3333	9.84e-06	3qvq:B, 3qvq:C, 3qvq:D
12	1t8q:B	329	106	0.1130	0.1033	0.3208	1.76e-05	1t8q:A, 1t8q:C, 1t8q:D, 1ydy:A, 1ydy:B
13	8cwp:A	327	226	0.2126	0.1957	0.2832	3.28e-05
14	3ks6:A	250	66	0.0764	0.0920	0.3485	4.99e-05	3ks5:A, 3ks5:B, 3ks6:B, 3ks6:C, 3ks6:D
15	7ww4:A	480	118	0.1096	0.0688	0.2797	0.014	7wwc:A
16	5g3r:A	335	201	0.1628	0.1463	0.2438	0.038	5g3r:B, 5g5k:A, 5g5k:B, 5g6t:A, 5g6t:B, 5ly7:A, 5ly7:B
17	3no3:A	238	284	0.2126	0.2689	0.2254	0.19
18	4rw3:A	279	69	0.0565	0.0609	0.2464	0.93	3rlg:A, 3rlh:A, 4rw5:A
19	7tjh:E	439	68	0.0731	0.0501	0.3235	2.3	7tji:E, 7tjj:E, 7tjk:E
20	7c7d:A	539	27	0.0432	0.0241	0.4815	4.5	7c7d:B
21	8bam:A	525	101	0.0897	0.0514	0.2673	7.1	8bam:B, 8bap:A, 8bap:B, 8bap:C, 8bap:D, 8bap:E, 8bap:F, 8bap:G, 8bap:H, 8bap:I, 8bap:J, 8bap:K, 8bap:L, 8bap:M, 8bap:N, 8bap:O, 8bap:P, 5fxd:A, 5fxd:B, 5fxe:A, 5fxe:B, 5fxf:A, 5fxf:B, 5fxp:A, 5fxp:B, 7ywu:A, 7ywu:B, 7ywu:C, 7ywu:D, 7ywu:E, 7ywu:F, 7ywu:G, 7ywu:H, 7ywv:A, 7ywv:B, 7ywv:C, 7ywv:D, 7ywv:E, 7ywv:F, 7ywv:G, 7ywv:H
22	3hmz:A	191	88	0.0797	0.1257	0.2727	7.8
23	5foo:A	463	21	0.0399	0.0259	0.5714	9.0	5foo:B, 5foo:C, 5foo:D, 5foo:E, 5foo:F

[Back]