BioLiP

>protein
DNLEQKILQVLSDDGGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSPSPKYWSIG

The query sequence (length=58) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2heo:A	59	58	1.0000	0.9831	1.0000	2.18e-37	2heo:D, 1j75:A
2	3f21:A	67	59	0.3448	0.2985	0.3390	6.08e-04	2acj:B, 2acj:C, 2acj:D, 3f21:B, 3f21:C, 3f22:A, 3f22:B, 3f22:C, 3f23:A, 3f23:B, 3f23:C, 2gxb:A, 2gxb:B, 3irq:B, 3irq:A, 3irq:D, 3irq:C, 3irr:C, 3irr:D, 3irr:A, 3irr:B, 1qbj:A, 1qbj:B, 1qbj:C, 5zu1:C, 5zu1:A, 5zu1:B, 5zuo:B, 5zuo:C, 5zuo:D, 5zup:B, 5zup:C, 5zup:D
3	4kmf:A	62	57	0.2931	0.2742	0.2982	0.003
4	2acj:A	53	59	0.3103	0.3396	0.3051	0.030	5zuo:A, 5zup:A
5	5zu1:D	47	60	0.3103	0.3830	0.3000	0.033
6	4b0n:A	379	34	0.2069	0.0317	0.3529	0.34	4b0n:B
7	1sfu:A	70	51	0.3103	0.2571	0.3529	0.45	1sfu:B
8	6hl7:C	322	35	0.2241	0.0404	0.3714	0.58
9	7zea:B	346	35	0.2241	0.0376	0.3714	0.67	6fba:A, 6fba:B, 6fba:C, 6hl7:A, 7zcz:A, 7zcz:C, 7zcz:B, 7zea:A, 7zgs:A, 7zgs:C, 7zgs:B, 7zhi:A, 7zhi:C, 7zhi:B, 7zid:B, 7zp2:A, 7zp2:B, 7zst:B, 7zst:C
10	7x5b:A	312	40	0.2414	0.0449	0.3500	0.98	6blb:A, 7x7p:M, 7x7p:P, 7x7q:M, 7x7q:P
11	4evi:A	360	59	0.2759	0.0444	0.2712	2.3	4e70:A, 4e70:B, 4evi:B
12	5yvg:B	764	41	0.2414	0.0183	0.3415	3.8
13	4chu:B	127	48	0.2414	0.1102	0.2917	4.0
14	4hf1:A	129	40	0.2069	0.0930	0.3000	4.7	4chu:A, 4hf1:B, 4hf2:A, 4hf2:B
15	6cig:A	349	35	0.1724	0.0287	0.2857	4.9	1fp2:A
16	2qyo:A	353	36	0.1552	0.0255	0.2500	8.3	2qyo:B
17	7ohg:A	351	52	0.2931	0.0484	0.3269	8.6	6s2t:A, 6s2u:A, 6s2v:A

[Back]