BioLiP

>protein
DLVDRLNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSE
NRSSKAAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHD
PATLRFGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWY
KGDQKQVQHACPTPLIALINRDNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD

The query sequence (length=305) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4xr0:A	308	305	1.0000	0.9903	1.0000	0.0	1ecr:A, 2ewj:A, 2i05:A, 2i06:A, 4xr1:A, 4xr2:A, 4xr3:A
2	2gk1:I	440	134	0.1016	0.0705	0.2313	1.5	2gk1:J, 2gk1:K, 2gk1:L
3	4lqx:B	309	48	0.0525	0.0518	0.3333	2.2	4lqx:A
4	4a8f:B	664	47	0.0590	0.0271	0.3830	8.0	4a8f:A, 4a8f:C, 4a8k:B, 4a8k:A, 4a8k:C, 4a8m:Q, 4a8m:P, 4a8m:R, 4a8o:A, 4a8o:B, 4a8o:C, 4a8q:A, 4a8q:B, 4a8q:C, 4a8s:A, 4a8s:B, 4a8s:C, 4a8w:A, 4a8w:B, 4a8w:C, 4a8y:A, 4a8y:B, 4a8y:C, 4b02:A, 4b02:B, 4b02:C, 5fj6:A, 5fj7:C, 1hhs:A, 1hhs:B, 1hhs:C, 1hht:P, 1hht:Q, 1hht:R, 1hi0:P, 1hi0:Q, 1hi0:R, 1hi1:A, 1hi1:B, 1hi1:C, 1hi8:A, 1hi8:B, 2jlf:A, 2jlf:B, 2jlg:A, 2jlg:B, 2jlg:C, 1uvi:A, 1uvi:B, 1uvi:C, 1uvj:A, 1uvj:B, 1uvj:C, 1uvk:A, 1uvk:C, 1uvk:E, 1uvl:A, 1uvl:C, 1uvl:E, 1uvm:A, 1uvm:B, 1uvm:C, 1uvn:A, 1uvn:C, 1uvn:E

[Back]