DKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWH
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hw2:B | 69 | 64 | 1.0000 | 0.9275 | 1.0000 | 4.96e-44 | 8jzw:C, 8jzw:D, 8jzw:A, 8jzw:B, 5t1i:A, 5t1i:B |
2 | 3q6s:B | 67 | 63 | 0.8906 | 0.8507 | 0.9048 | 5.16e-40 | 3q6s:A, 3q6s:C, 3q6s:D, 5t1g:A |
3 | 8uxq:A | 170 | 64 | 0.8594 | 0.3235 | 0.8594 | 5.16e-37 | 3fdt:A |
4 | 8uxq:A | 170 | 44 | 0.1875 | 0.0706 | 0.2727 | 0.039 | 3fdt:A |
5 | 3tzd:A | 58 | 44 | 0.2031 | 0.2241 | 0.2955 | 7.63e-04 | 3dm1:A, 3dm1:C, 3dm1:G, 3dm1:E, 2l11:A |
6 | 1guw:A | 73 | 42 | 0.2031 | 0.1781 | 0.3095 | 0.002 | 6d07:A, 6d07:B, 6d08:A, 6d08:B |
7 | 2rvn:A | 83 | 44 | 0.1875 | 0.1446 | 0.2727 | 0.013 | |
8 | 6zj3:Lf | 170 | 60 | 0.2812 | 0.1059 | 0.3000 | 0.69 | |
9 | 5ftw:A | 255 | 35 | 0.2188 | 0.0549 | 0.4000 | 0.74 | |
10 | 6asz:A | 53 | 44 | 0.1719 | 0.2075 | 0.2500 | 0.93 | 6at0:A, 1kna:A, 1kne:A, 6mha:A, 1q3l:A |
11 | 5g3z:A | 215 | 51 | 0.2188 | 0.0651 | 0.2745 | 1.2 | 5g40:A, 5g41:A |
12 | 7dco:Q | 292 | 31 | 0.1719 | 0.0377 | 0.3548 | 2.5 | 6j6g:Q, 6j6h:Q, 6j6n:Q, 6j6q:Q |
13 | 5epk:A | 54 | 44 | 0.1875 | 0.2222 | 0.2727 | 5.4 | 3h91:A, 3h91:B |
14 | 1uuy:A | 161 | 15 | 0.1406 | 0.0559 | 0.6000 | 9.1 |