BioLiP

>protein
DKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSAST
KSLQELFLAHILSPWG

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7scy:K	96	96	1.0000	1.0000	1.0000	1.31e-65	7scz:K
2	2k7f:A	109	21	0.1146	0.1009	0.5238	0.19
3	6nlx:C	335	79	0.2604	0.0746	0.3165	0.60	6nlx:B, 6nlx:D, 5ur0:A, 5ur0:B, 5ur0:C, 5ur0:D
4	6nys:B	679	48	0.1562	0.0221	0.3125	1.5	6nys:A
5	5xy3:B	400	35	0.1771	0.0425	0.4857	2.3
6	1soj:B	381	34	0.1250	0.0315	0.3529	2.3	1so2:A, 1so2:B, 1so2:C, 1so2:D, 1soj:A, 1soj:C, 1soj:D, 1soj:E, 1soj:F, 1soj:G, 1soj:H, 1soj:I, 1soj:J, 1soj:K, 1soj:L, 8syc:A, 8syc:D
7	7v94:A	1076	81	0.1771	0.0158	0.2099	2.7	7v93:A
8	8y6h:A	610	20	0.1042	0.0164	0.5000	4.4
9	8y6i:A	646	20	0.1042	0.0155	0.5000	4.4
10	5nlm:B	448	39	0.1354	0.0290	0.3333	5.8
11	5n5s:B	481	81	0.2083	0.0416	0.2469	5.8	5n5s:A, 5n5s:C, 5n5s:D
12	6su6:A	467	39	0.1354	0.0278	0.3333	5.9	5nlm:A, 6su6:B, 6su7:A
13	6qex:A	1182	20	0.1042	0.0085	0.5000	6.3	7a65:A, 7a69:A, 7a6c:A, 7a6e:A, 7a6f:A, 6c0v:A, 7o9w:A
14	7px0:B	1253	28	0.0833	0.0064	0.2857	6.5	7px0:A, 7px0:C, 7px0:D
15	6mu1:A	2149	62	0.1771	0.0079	0.2742	6.5	6mu1:C, 6mu1:B, 6mu1:D
16	8e5t:5	530	48	0.1458	0.0264	0.2917	8.1
17	5ow5:B	77	59	0.1250	0.1558	0.2034	8.3	5ow5:D
18	5e72:A	323	17	0.1042	0.0310	0.5882	8.3
19	4dna:A	461	49	0.1458	0.0304	0.2857	9.0	4dna:B

[Back]