DISKVAWAWFGVLLAICLIGAFGNYVPKLFVKMLMFLN
The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7vzg:G | 38 | 38 | 1.0000 | 1.0000 | 1.0000 | 1.11e-21 | 7vzg:g, 7vzr:G, 7vzr:g |
| 2 | 6lcp:A | 1140 | 15 | 0.2368 | 0.0079 | 0.6000 | 2.4 | 6lcr:A |
| 3 | 8aej:A | 160 | 15 | 0.2105 | 0.0500 | 0.5333 | 4.2 | |
| 4 | 1gm6:A | 158 | 15 | 0.2105 | 0.0506 | 0.5333 | 7.5 | |
| 5 | 6tej:B | 585 | 20 | 0.2368 | 0.0154 | 0.4500 | 7.6 |
umich.edu