DHLSKIFLTISKSITQNPWNEENLLPLWLKWLLTLKSGELNSIKDKHTKKNCKHLKSALRSSEEILPVLLGIQGRLEMLR
The query sequence (length=88) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7d4i:A9 |
128 |
88 |
1.0000 |
0.6875 |
1.0000 |
1.65e-58 |
7aju:UI, 7d5s:A9, 7d63:A9, 6ke6:A9, 6lqp:A9, 6lqq:A9, 6lqr:A9, 6lqs:A9, 6lqt:A9, 6lqu:A9, 6lqv:A9, 6zqb:UI |
2 |
7d5s:A5 |
514 |
53 |
0.2045 |
0.0350 |
0.3396 |
0.037 |
7ajt:UE, 6ke6:A5, 6lqp:A5, 6lqq:A5, 6lqu:A5, 6nd4:L, 7suk:LL, 5wlc:LL, 6zqa:UE, 6zqb:UE, 6zqc:UE |
3 |
8i22:A |
530 |
26 |
0.1364 |
0.0226 |
0.4615 |
0.53 |
8i22:F, 8i22:B, 8i22:C, 8i22:D, 8i22:E, 8i3i:A, 8i3i:D, 8i3i:B, 8i3i:C, 8i49:A, 8i49:D, 8i49:E, 8i49:F, 8i49:C, 8i49:B, 8i51:A, 8i51:B, 8i51:C, 8i51:D, 8i51:E, 8i51:F, 8i6m:A, 8i6m:F, 8i6m:D, 8i6m:C, 8i6m:B, 8i6m:E, 8i8d:A, 8i8d:B, 8i8d:C, 8i8d:D, 8i8d:E, 8i8d:F, 8i8e:F, 8i8e:D, 8i8e:A, 8i8e:B, 8i8e:C, 8i8e:E, 8jyl:A, 8jyl:B, 8jyl:C, 8jyl:D, 8jyl:E, 8jyl:F, 8jyu:A, 8jyu:D, 8jyu:B, 8jyu:C, 8jyu:E, 8jyu:F |
4 |
7c9i:C |
243 |
34 |
0.1364 |
0.0494 |
0.3529 |
1.4 |
7d8x:C, 6idf:C, 8im7:C, 6iyc:C, 8k8e:C, 8kco:C, 8kcp:C, 8kcs:C, 8kct:C, 8kcu:C, 6lqg:C, 6lr4:C, 8x52:C, 8x53:C, 8x54:C, 7y5t:C, 7y5x:C, 7y5z:C |
5 |
3jd5:c |
168 |
66 |
0.2045 |
0.1071 |
0.2727 |
1.4 |
6neq:c, 6nf8:c |
6 |
8uiv:A |
375 |
48 |
0.1591 |
0.0373 |
0.2917 |
1.6 |
5eow:A, 8uiq:A |
7 |
6rxt:UE |
125 |
60 |
0.2045 |
0.1440 |
0.3000 |
4.9 |
6rxu:UE, 6rxv:UE, 6rxy:UE, 6rxz:UE |
8 |
7u3d:C |
677 |
38 |
0.1250 |
0.0162 |
0.2895 |
6.8 |
|
9 |
8pp6:G |
109 |
53 |
0.1705 |
0.1376 |
0.2830 |
8.8 |
8pp7:G, 2pyo:G, 8ux1:G |