BioLiP

>protein
DHDAEVLDSIMDRLHEPLYEKDTFDPNEVLAENKQLYEEFLLQEISEPKVDNLVRSGDPLAGKAKGTILSLVRNSDLEDI
ISSIQQLEEEYNKNFGYPYTFLNDEEFTDEFKDGIKSILPKDRVVEFGTIGPDNWNMPDSIDRERYDQEMDKMSKENIQY
AEVESYHNMCRFYSKEFYHHPLLSKYKYVWRLEPNVNFYCKINYDVFQFMNKNDKIYGFVLNLYDSPQTIETLWTSTMDF
VEEHPNYLNVNGAFAWLKDNSQNPKNYDYTQGYSTCHFWTNFEIVDLDFLRSEPYEKYMQYLEEKGGFYYERWGDAPVRS
LALALFADKSSIHWFRDIGYHHTPYTNCPTCPADSDRCNGNCVPGKFTPWSDLDNQNCQATWIRHSMSEEELEMY

The query sequence (length=395) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5a07:A	395	395	1.0000	1.0000	1.0000	0.0	5a07:B, 5a08:B
2	7bop:C	372	352	0.3797	0.4032	0.4261	3.47e-105	7bop:A, 7bop:B, 7bop:D, 7bop:E, 7bop:F
3	1s4o:A	335	291	0.3215	0.3791	0.4364	6.96e-87	1s4o:B, 1s4p:A, 1s4p:B
4	2c1d:B	137	42	0.0405	0.1168	0.3810	0.24	2c1d:D, 2c1d:F, 2c1d:H
5	7pug:A	829	109	0.0709	0.0338	0.2569	2.4	7pxq:A
6	8c79:A	478	123	0.0810	0.0669	0.2602	2.5	8c79:B
7	8olx:B	836	109	0.0658	0.0311	0.2385	3.1	8om5:B, 8om9:B
8	3thw:B	860	109	0.0658	0.0302	0.2385	3.1	8oma:B, 8omo:B, 8omq:B, 3thx:B, 3thy:B, 3thz:B
9	7f09:C	67	39	0.0354	0.2090	0.3590	6.7
10	6ky3:A	353	65	0.0506	0.0567	0.3077	8.2
11	2g37:B	300	54	0.0380	0.0500	0.2778	8.6	2ekg:A, 2ekg:B, 2g37:A, 5m42:A
12	7oui:H	60	37	0.0329	0.2167	0.3514	8.9	3jcu:H, 3jcu:h, 5mdx:H, 5mdx:h, 7oui:h
13	8t41:A	859	46	0.0430	0.0198	0.3696	9.8

[Back]