DGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQKKLKSVRA
The query sequence (length=47) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7aju:UC | 86 | 47 | 1.0000 | 0.5465 | 1.0000 | 3.86e-26 | 6zqd:UC, 6zqe:UC |
| 2 | 7suk:NB | 142 | 47 | 1.0000 | 0.3310 | 1.0000 | 5.02e-26 | 7ajt:UC, 7d5s:5H, 7d5t:5H, 7d63:5H, 6ke6:5H, 6lqp:5H, 6lqq:5H, 6lqr:5H, 6lqs:5H, 6lqt:5H, 6lqu:5H, 6lqv:5H, 5wlc:NB, 7wtl:UC, 6zqa:UC, 6zqb:UC, 6zqc:UC, 6zqf:UC, 6zqg:UC |
| 3 | 7d4i:5H | 95 | 46 | 0.9787 | 0.4842 | 1.0000 | 4.67e-25 | |
| 4 | 5oql:C | 74 | 46 | 0.6809 | 0.4324 | 0.6957 | 4.15e-15 | 6rxt:UC, 6rxu:UC, 6rxv:UC, 6rxx:UC, 6rxy:UC, 6rxz:UC |
| 5 | 7mqa:NB | 103 | 37 | 0.4894 | 0.2233 | 0.6216 | 1.02e-09 | 7mq8:NB, 7mq9:NB |
| 6 | 8i22:A | 530 | 26 | 0.2128 | 0.0189 | 0.3846 | 7.8 | 8i22:F, 8i22:B, 8i22:C, 8i22:D, 8i22:E, 8i3i:A, 8i3i:D, 8i3i:B, 8i3i:C, 8i49:A, 8i49:D, 8i49:E, 8i49:F, 8i49:C, 8i49:B, 8i51:A, 8i51:B, 8i51:C, 8i51:D, 8i51:E, 8i51:F, 8i6m:A, 8i6m:F, 8i6m:D, 8i6m:C, 8i6m:B, 8i6m:E, 8i8d:A, 8i8d:B, 8i8d:C, 8i8d:D, 8i8d:E, 8i8d:F, 8i8e:F, 8i8e:D, 8i8e:A, 8i8e:B, 8i8e:C, 8i8e:E, 8jyl:A, 8jyl:B, 8jyl:C, 8jyl:D, 8jyl:E, 8jyl:F, 8jyu:A, 8jyu:D, 8jyu:B, 8jyu:C, 8jyu:E, 8jyu:F |
| 7 | 1jv1:A | 490 | 27 | 0.1489 | 0.0143 | 0.2593 | 8.2 | 1jv1:B, 1jv3:A, 1jv3:B, 1jvd:A, 1jvd:B, 1jvg:A, 1jvg:B, 6z2f:A, 6z2f:B |
| 8 | 2v6g:A | 364 | 22 | 0.1915 | 0.0247 | 0.4091 | 9.1 |
umich.edu