Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
DGFDSRGKREFDRHSGSDRSGLKHEDKRGGSGSHNWGTVKDELTDLDQSTLDEWKAIQNKD

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7ls1:A 61 61 1.0000 1.0000 1.0000 1.71e-38 7ls2:A, 6mte:w, 7oyd:w, 8q87:S, 8xsx:CD, 8y0w:S, 8y0x:S, 6z6m:CD
2 7oyc:i2 51 54 0.4918 0.5882 0.5556 5.24e-17
3 7oya:i2 36 36 0.3934 0.6667 0.6667 4.57e-12
4 4v6x:Ah 73 14 0.1967 0.1644 0.8571 0.033 6z6n:CD
5 4v6w:Ah 58 12 0.1639 0.1724 0.8333 0.49
6 6jci:A 704 27 0.1967 0.0170 0.4444 3.7
7 8imx:T 530 29 0.1803 0.0208 0.3793 4.6 8imy:T, 7w72:T
8 6akv:A 151 40 0.1967 0.0795 0.3000 6.6
9 6ot4:A 106 26 0.1803 0.1038 0.4231 8.8 6ot4:B, 6ot4:D, 6ot4:C, 6ot7:D, 6ot7:C, 6ot7:A, 6ot7:B, 6ot8:A, 6ot9:C, 6ot9:A, 6ot9:D, 6ot9:B, 6ovh:A, 6ovh:B, 6ovh:C, 6ovh:L, 6ovh:D, 6ovh:G, 6ovh:E, 6ovh:F, 6ovh:H, 6ovh:K, 6ovh:I, 6ovh:J

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023)(download the PDF file).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417