DEPFSGAKKLRHLLENTDELIVCPGVYDGLSARTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDP
FGPPLIADMDTGYGGPIMVARTVEHYIRSGVAGAHLEDQILTKRCGHLSGKKVVSRDEYLVRIRAAVATKRRLRSDFVLI
ARTDALQSLGYEECIERLRAARDEGADVGLLEGFRSKEQAAAAVAALAPWPLLLNSVENGHSPLITVEEAKAMGFRIMIF
SFATLAPAYAAIRETLVRLRDHGVVGTPDGITPVRLFEVCGLQDAMEVDNGAGGKAF
The query sequence (length=297) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3m0j:A | 297 | 297 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3lye:A, 3m0k:A |
2 | 3fa3:B | 302 | 293 | 0.5960 | 0.5861 | 0.6041 | 1.82e-122 | 3fa3:A, 3fa3:C, 3fa3:D, 3fa3:E, 3fa3:F, 3fa3:G, 3fa3:H, 3fa3:I, 3fa3:J, 3fa3:K, 3fa3:L, 3fa3:M, 3fa3:N, 3fa3:O, 3fa3:P, 3fa4:A, 3fa4:B, 3fa4:C, 3fa4:D, 3fa4:E, 3fa4:F, 3fa4:G, 3fa4:H, 3fa4:I, 3fa4:J, 3fa4:K, 3fa4:L |
3 | 4iqd:A | 290 | 290 | 0.3266 | 0.3345 | 0.3345 | 3.00e-43 | 4iqd:B |
4 | 1mum:A | 289 | 263 | 0.3098 | 0.3183 | 0.3498 | 4.70e-35 | 1o5q:A, 1o5q:B, 1o5q:C, 1o5q:D, 1xg3:A, 1xg3:B, 1xg3:C, 1xg3:D |
5 | 1zlp:B | 285 | 274 | 0.2929 | 0.3053 | 0.3175 | 8.85e-28 | 1zlp:A |
6 | 6t4v:C | 277 | 244 | 0.2694 | 0.2888 | 0.3279 | 1.15e-26 | 6t4v:A, 6t4v:B, 6t4v:D, 6t5m:C, 6t5m:A, 6t5m:D, 6t5m:B |
7 | 6t4v:C | 277 | 40 | 0.0572 | 0.0614 | 0.4250 | 3.0 | 6t4v:A, 6t4v:B, 6t4v:D, 6t5m:C, 6t5m:A, 6t5m:D, 6t5m:B |
8 | 1m1b:A | 291 | 288 | 0.2593 | 0.2646 | 0.2674 | 1.25e-17 | 1m1b:B, 1pym:A, 1pym:B |
9 | 3b8i:A | 284 | 234 | 0.2424 | 0.2535 | 0.3077 | 9.26e-17 | 3b8i:B, 3b8i:C, 3b8i:D, 3b8i:E, 3b8i:F |
10 | 5e9h:A | 518 | 194 | 0.2155 | 0.1236 | 0.3299 | 1.19e-14 | |
11 | 7rbx:C | 425 | 183 | 0.1751 | 0.1224 | 0.2842 | 2.52e-14 | 7rbx:A, 7rbx:B, 7rbx:D |
12 | 6lrt:A | 423 | 180 | 0.1751 | 0.1229 | 0.2889 | 4.55e-14 | 6lrt:D, 6lrt:G, 6lrt:J, 6lrt:M, 6lrt:P, 6lrt:S, 6lrt:V |
13 | 6edw:C | 724 | 188 | 0.1919 | 0.0787 | 0.3032 | 5.92e-13 | 6ee1:A, 6ee1:C |
14 | 5unc:A | 289 | 162 | 0.1785 | 0.1834 | 0.3272 | 5.94e-13 | 5unc:B, 5unc:C, 5unc:D |
15 | 2dua:A | 283 | 270 | 0.2492 | 0.2615 | 0.2741 | 7.21e-13 | 2hjp:A |
16 | 6edw:B | 746 | 188 | 0.1919 | 0.0764 | 0.3032 | 7.40e-13 | 6edw:A, 6edw:D, 6edz:A, 6edz:B, 6edz:D, 6ee1:B, 6ee1:D |
17 | 7ebe:A | 544 | 86 | 0.1178 | 0.0643 | 0.4070 | 7.67e-13 | 7ebe:B, 7ebe:C, 7ebe:D |
18 | 5e9g:B | 525 | 92 | 0.1313 | 0.0743 | 0.4239 | 8.47e-13 | 5e9f:A, 5e9g:A |
19 | 5e9g:D | 486 | 92 | 0.1313 | 0.0802 | 0.4239 | 8.93e-13 | |
20 | 8z1r:B | 516 | 83 | 0.1145 | 0.0659 | 0.4096 | 1.44e-11 | 8z1r:A |
21 | 6c4a:A | 428 | 186 | 0.1852 | 0.1285 | 0.2957 | 5.55e-11 | 6c4a:B, 6c4a:C, 6c4a:D, 6c4a:E, 6c4a:F, 6c4a:G, 6c4a:H, 6c4c:A, 6c4c:B, 6c4c:C, 6c4c:D, 6c4c:E, 6c4c:F, 6c4c:G, 6c4c:H, 7cp1:A, 7cp1:B, 5dql:A, 5dql:B, 5dql:C, 5dql:D, 1f61:A, 1f61:B, 1f8i:A, 1f8i:B, 1f8i:C, 1f8i:D, 1f8m:A, 1f8m:B, 1f8m:C, 1f8m:D, 7rb1:A, 7rb1:B, 7rb1:C, 7rb1:D, 6vb9:A, 6vb9:B, 6vb9:C, 6vb9:D, 6wsi:A, 6wsi:B, 6wsi:C, 6wsi:D, 6xpp:A, 6xpp:B, 6xpp:C, 6xpp:D |
22 | 7cmy:C | 417 | 180 | 0.1616 | 0.1151 | 0.2667 | 9.59e-11 | |
23 | 4lsb:B | 278 | 220 | 0.2357 | 0.2518 | 0.3182 | 5.45e-10 | 4lsb:A |
24 | 1igw:C | 416 | 192 | 0.1852 | 0.1322 | 0.2865 | 1.04e-09 | 1igw:B, 1igw:D |
25 | 6edz:C | 723 | 187 | 0.1818 | 0.0747 | 0.2888 | 2.06e-08 | |
26 | 2ze3:A | 275 | 184 | 0.2054 | 0.2218 | 0.3315 | 6.64e-08 | |
27 | 6g1o:A | 486 | 105 | 0.1145 | 0.0700 | 0.3238 | 1.27e-07 | |
28 | 5e9f:B | 501 | 91 | 0.1145 | 0.0679 | 0.3736 | 2.93e-07 | 5e9f:C, 5e9g:C |
29 | 5e9f:D | 453 | 91 | 0.1145 | 0.0751 | 0.3736 | 3.43e-07 | |
30 | 1igw:A | 396 | 192 | 0.1785 | 0.1338 | 0.2760 | 6.86e-06 | |
31 | 1m8k:A | 169 | 107 | 0.1010 | 0.1775 | 0.2804 | 0.36 | 1ej2:A, 1hyb:A, 1m8f:A, 1m8g:A, 1m8j:A, 1m8k:B, 1m8k:C, 4yp5:A, 4yp5:B, 4yp5:C, 4yp6:A, 4yp6:B, 4yp6:C, 4yp7:A, 4yp7:B, 4yp7:C |
32 | 2ww2:B | 737 | 69 | 0.0572 | 0.0231 | 0.2464 | 4.9 | |
33 | 6grh:C | 266 | 57 | 0.0640 | 0.0714 | 0.3333 | 5.0 | 6gos:C, 6grg:C, 6gri:C |
34 | 4xfm:A | 400 | 43 | 0.0640 | 0.0475 | 0.4419 | 6.0 |